DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MARK1 and CG9222

DIOPT Version :9

Sequence 1:NP_001273053.1 Gene:MARK1 / 4139 HGNCID:6896 Length:796 Species:Homo sapiens
Sequence 2:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster


Alignment Length:260 Identity:103/260 - (39%)
Similarity:159/260 - (61%) Gaps:16/260 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    62 LQKTIGKGNFAKVKLARHVLTGREVAVKIIDKTQLNPTSLQK-LFREVRIMKILNHPNIVKLFEV 125
            |.|.||.||:||||:......|:.||||||.|.:......|| |.||:..:|.|:|.|::..::.
  Fly    78 LGKVIGTGNYAKVKIGFSEEYGKRVAVKIISKVKAPSEYTQKFLPREIEAVKGLHHENLITFYQS 142

Human   126 IETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKYIVHRDLKAENLLL 190
            |||...:||:|:.|..|.:.||:.....:.|.::|..|:|:||||:|.|.|.:||||:|.|||||
  Fly   143 IETSHRVYLIMQLAENGTLLDYVRERKFLDEPQSRTLFKQLVSAVEYIHSKGVVHRDIKCENLLL 207

Human   191 DGDMNIKIADFGFSNE--FTVGNKL---DTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTL 250
            |.:.|:|:.||||:.:  .|..|::   .|||||..||:||:.:|..||....|:|:.||:.|.:
  Fly   208 DENWNLKLIDFGFARKDTRTSDNQVILSKTFCGSYAYASPEILKGVAYDPFMSDIWACGVVCYAM 272

Human   251 VSGSLPFDGQNLKELRERVLRGKYRIPF----YMSTDCENLLKKLLVLNPIK-RGSLEQIMKDRW 310
            |.|.||:||.|:..|.:|:   ...:.|    ..|::|::::  :.:|.|:| |.::.|:.:|.|
  Fly   273 VFGRLPYDGSNVHILLKRI---NQSLVFPKSPSASSECKHMI--MHILAPVKIRYNIPQVKEDPW 332

Human   311  310
              Fly   333  332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MARK1NP_001273053.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
STKc_MARK 59..311 CDD:270974 103/260 (40%)
S_TKc 60..311 CDD:214567 103/260 (40%)
UBA_MARK1 331..371 CDD:270588
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 377..495
MARK1-3_C 697..794 CDD:213381
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 103/260 (40%)
S_TKc 78..332 CDD:214567 102/258 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.