DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5342 and AT4G29680

DIOPT Version :10

Sequence 1:NP_650088.2 Gene:CG5342 / 41389 FlyBaseID:FBgn0037916 Length:837 Species:Drosophila melanogaster
Sequence 2:NP_194697.1 Gene:AT4G29680 / 829089 AraportID:AT4G29680 Length:496 Species:Arabidopsis thaliana


Alignment Length:265 Identity:51/265 - (19%)
Similarity:93/265 - (35%) Gaps:86/265 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LRSTYPGSLEPQEVEHLKEPPPADRLVVLVRDGLSAQSFLANRCTNVPLLRELFLHQGLVGISRP 88
            |.:..|.|: |||.:   :.||:..:.:|.....|:.|..:.|.     :...|:...|:.::  
plant     7 LSAKKPKSV-PQEED---QDPPSQSIALLDNHTDSSGSDSSTRS-----ISSCFIFTSLLLVT-- 60

  Fly    89 ETITYHSISPYISLFSGFNEDAASVARGWLGTPASIDSIFDRCKRSFAWTTTELISR-FPKIERP 152
             .|...:.|.:..||....:...|:      ...|....|||.           ::| ..|:::|
plant    61 -CIALSAASAFAFLFFSSQKPVLSL------NQISKSPAFDRS-----------VARPLKKLDKP 107

  Fly   153 RELSFETYG-----EGVTKSCSEMEDFVCRSVQRFLGGGSRLLLNTTGVIFFIHMTGVEPSCESL 212
            ..|...:.|     :..||         ..|:.|.:..|:..            .||:.|...:|
plant   108 VVLLISSDGFRFGYQFKTK---------LPSIHRLIANGTEA------------ETGLIPVFPTL 151

  Fly   213 QRIQENVWNVYKSFEKTFPDQRT-------AY--LFTSNLGDPQTKSEYSLAVESPFF-----LW 263
                            |||:..:       ||  :..::..||:|.:.:::|...|.:     ||
plant   152 ----------------TFPNHYSIVTGLYPAYHGIINNHFVDPETGNVFTMASHEPEWWLGEPLW 200

  Fly   264 GSGVN 268
            .:.||
plant   201 ETVVN 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5342NP_650088.2 GPI_EPT_1 43..318 CDD:293744 45/246 (18%)
PigN 397..781 CDD:461508
AT4G29680NP_194697.1 Phosphodiest 109..435 CDD:396300 25/134 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.