DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6790 and NPP1

DIOPT Version :9

Sequence 1:NP_650087.2 Gene:CG6790 / 41388 FlyBaseID:FBgn0037915 Length:897 Species:Drosophila melanogaster
Sequence 2:NP_009955.2 Gene:NPP1 / 850391 SGDID:S000000621 Length:742 Species:Saccharomyces cerevisiae


Alignment Length:242 Identity:46/242 - (19%)
Similarity:76/242 - (31%) Gaps:82/242 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 DIILRQGLVGISKTSVPTLTRSAEVALFAGFNPMPSILPTSNFDTIFNRTLAFDKGAFLRFSHLS 179
            |..|:|.:..:.:.::.:.|.    .:....:.|..|:..||  .|....|..:|          
Yeast   389 DTFLKQLVESLQERNLTSFTN----LVIVSDHGMSDIVVPSN--VIIWEDLLDEK---------- 437

  Fly   180 DLRRRLTKRACLEKLWYANKLVMLVNLAEVGGASPLDIGFQMKLHNTQRNI-RDAYELI------ 237
             ||:.....|.||      ..:|.::|.:.|..:.:       .||.:.:| .|.|.:.      
Yeast   438 -LRKDYVSHAYLE------GPMMAISLKDSGNINEV-------YHNLKTSIDEDKYTVYVNGNFP 488

  Fly   238 -EATFNDSKT------------AYLYTSAHGLTYFGSHGGGSDEEREAPFLLWGAGVKHVTENIT 289
             |..|||.|.            .|.......|... :.|...|:..:..|.:...|..       
Yeast   489 KEWNFNDGKNHHMASIWIVPEPGYAVMKKEQLKKV-AKGDHKDKNEDNVFTIGSHGYD------- 545

  Fly   290 SDFVLNNGVGMQLHKLDQIQLAPLMSALIGLPPPVNNLAILPQGYMK 336
                 ||.:.|:             |..||:.|      ..||||::
Yeast   546 -----NNAIDMR-------------SVFIGMGP------YFPQGYIE 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6790NP_650087.2 GPI_EPT_1 83..331 CDD:293744 42/235 (18%)
PigN 418..821 CDD:282796
NPP1NP_009955.2 Phosphodiest 170..545 CDD:396300 35/186 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.