DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6790 and AT4G29710

DIOPT Version :10

Sequence 1:NP_650087.2 Gene:CG6790 / 41388 FlyBaseID:FBgn0037915 Length:897 Species:Drosophila melanogaster
Sequence 2:NP_194700.1 Gene:AT4G29710 / 829092 AraportID:AT4G29710 Length:133 Species:Arabidopsis thaliana


Alignment Length:38 Identity:8/38 - (21%)
Similarity:22/38 - (57%) Gaps:1/38 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 GMQLHKLDQIQLAPLMSALIGL-PPPVNNLAILPQGYM 335
            |.::...:.:|:..:::.::|| |.|.|..::.|:..:
plant    86 GKKVPSFENVQIYSVVADILGLRPAPNNGSSLFPRSIL 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6790NP_650087.2 GPI_EPT_1 83..331 CDD:293744 7/32 (22%)
PigN 418..821 CDD:461508
AT4G29710NP_194700.1 ALP_like <1..66 CDD:474031
ALP_like <61..106 CDD:474031 2/19 (11%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.