| Sequence 1: | NP_650087.2 | Gene: | CG6790 / 41388 | FlyBaseID: | FBgn0037915 | Length: | 897 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_194700.1 | Gene: | AT4G29710 / 829092 | AraportID: | AT4G29710 | Length: | 133 | Species: | Arabidopsis thaliana |
| Alignment Length: | 38 | Identity: | 8/38 - (21%) |
|---|---|---|---|
| Similarity: | 22/38 - (57%) | Gaps: | 1/38 - (2%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 299 GMQLHKLDQIQLAPLMSALIGL-PPPVNNLAILPQGYM 335 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG6790 | NP_650087.2 | GPI_EPT_1 | 83..331 | CDD:293744 | 7/32 (22%) |
| PigN | 418..821 | CDD:461508 | |||
| AT4G29710 | NP_194700.1 | ALP_like | <1..66 | CDD:474031 | |
| ALP_like | <61..106 | CDD:474031 | 2/19 (11%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||