DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6790 and ENPP5

DIOPT Version :9

Sequence 1:NP_650087.2 Gene:CG6790 / 41388 FlyBaseID:FBgn0037915 Length:897 Species:Drosophila melanogaster
Sequence 2:NP_001277001.1 Gene:ENPP5 / 59084 HGNCID:13717 Length:477 Species:Homo sapiens


Alignment Length:408 Identity:87/408 - (21%)
Similarity:136/408 - (33%) Gaps:139/408 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SKVVLVHLLLLICIMRIFYQSGPLSQLEPQKTLLDMGVPPAADRLVVFLLEGLRADTLFSDNCSG 109
            ||.:||..:|....:...:...|    :.||.|           ||.|  :|.|.|.|:......
Human     3 SKFLLVSFILAALSLSTTFSLQP----DQQKVL-----------LVSF--DGFRWDYLYKVPTPH 50

  Fly   110 AVYIRDIILRQGLVGISKTSV-PTLTRSAEVALFAG-FNPMPSILPTSNFDTIFNRTLAFDKGAF 172
            ..|    |::.|:.....|:| .|.|......|..| |.....|:....||.|.|::.:.|    
Human    51 FHY----IMKYGVHVKQVTNVFITKTYPNHYTLVTGLFAENHGIVANDMFDPIRNKSFSLD---- 107

  Fly   173 LRFSHLSDLRRRLTKRACLEKLWYANKLVMLVNLAEVGGAS--PLDIGFQMKLH----------N 225
                |::....:..:.|  ..:|..|:     ......||:  |   |..:|:|          |
Human   108 ----HMNIYDSKFWEEA--TPIWITNQ-----RAGHTSGAAMWP---GTDVKIHKRFPTHYMPYN 158

  Fly   226 TQRNIRDAYELIEATFNDSKTAYLYTSAHGLTYF------GSHGGG---------SDEEREAPFL 275
            ...:..|....|...|...:...|     ||.|:      |.|.|.         ||.:::..:|
Human   159 ESVSFEDRVAKIIEWFTSKEPINL-----GLLYWEDPDDMGHHLGPDSPLMGPVISDIDKKLGYL 218

  Fly   276 --------LWGAGVKHVTEN--ITSDFVLNNGVGMQLHKLDQ---------IQLAPLMSALIGLP 321
                    ||.      |.|  ||||..:......:|.:|||         |..:|:        
Human   219 IQMLKKAKLWN------TLNLIITSDHGMTQCSEERLIELDQYLDKDHYTLIDQSPV-------- 269

  Fly   322 PPVNNLAILP-QGYMKVSREYARKSVHLNALQLLTQAKAIIRLHER-GVFHKWLPKDKDLDLQQI 384
                 .|||| :|  |....|          :.||.|...:.:::: .|..:|..|         
Human   270 -----AAILPKEG--KFDEVY----------EALTHAHPNLTVYKKEDVPERWHYK--------- 308

  Fly   385 AYYQNQMDHLL---DMGW 399
              |.:::..::   |.||
Human   309 --YNSRIQPIIAVADEGW 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6790NP_650087.2 GPI_EPT_1 83..331 CDD:293744 63/295 (21%)
PigN 418..821 CDD:282796
ENPP5NP_001277001.1 Phosphodiest 30..342 CDD:307681 79/377 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.