DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6790 and enpp5

DIOPT Version :9

Sequence 1:NP_650087.2 Gene:CG6790 / 41388 FlyBaseID:FBgn0037915 Length:897 Species:Drosophila melanogaster
Sequence 2:XP_005160520.3 Gene:enpp5 / 563498 ZFINID:ZDB-GENE-041014-10 Length:512 Species:Danio rerio


Alignment Length:437 Identity:75/437 - (17%)
Similarity:115/437 - (26%) Gaps:210/437 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LVHLLLLICIMRIFYQSGPLSQLEPQKTLLDMGVPPAADRLVVFLLEGLRADTLFSDNCSGAVYI 113
            ::....|.|::.:...||  ||.|.|..||          ||.|  :|.|.|           ||
Zfish    45 VIRSCFLSCLLALLQTSG--SQQEEQNQLL----------LVSF--DGFRWD-----------YI 84

  Fly   114 RDI-------ILRQG-LVGISKTSVPTLTRSAEVALFAGFN-PMPSILPTSNFDTIFNRTLAFD- 168
            ..:       ::.:| ||...:.:..|.|......|..|.: ....::....:|.|.||:.:.: 
Zfish    85 NRVPTPNFHALMDEGVLVEKVENTYITKTYPNHYTLVTGLHAESHGVVANEMYDPIHNRSFSIEG 149

  Fly   169 ---------KGAFLRFSHLSDLRRRLTKRACLEKLWYANKLVMLVNLAEVGGASPLDIGFQMKLH 224
                     :.|                    |.||..|:.....:.|.:...|.:.||.....|
Zfish   150 PEVYDAWWWEEA--------------------EPLWVTNQKAGRKSGAAMWPGSDVAIGGTFPTH 194

  Fly   225 NTQRNIRDAYE--------------------------------------LIEATFND-------- 243
            ..:.|....:|                                      |::....|        
Zfish   195 YLRYNASMLFETRVQKLIDWFSGPEAINFGVLYWEEPDESGHNLGPESPLMDVVLADIDEKLGFL 259

  Fly   244 ---SKTAYLY-------TSAHGLTYFGSHG----------------------------GGSDEE- 269
               .|:|.||       ||.||:|.. ||.                            .|..|| 
Zfish   260 REKLKSAGLYDKVNLIVTSDHGMTQL-SHDKIIELDTYVSRDLYTWIDKSPVVGILPKEGKLEEV 323

  Fly   270 -----------------------------REAPFLL-----WGAGVKHVTENITSDFVL-NNGVG 299
                                         |..|.::     |     .|.:|....|:| |:|..
Zfish   324 YGLLKNANPNMVVYKKEEIPDHYHYRHNARIMPLIIEVKEGW-----TVMQNRNGSFMLGNHGYN 383

  Fly   300 MQLHKLD--------------------QIQLAPLMSALIGLPPPVNN 326
            ..|..:.                    .:.|.|||.:::.|.|..||
Zfish   384 NSLPNMHPVFVARGPAFRRDYTKTSMRSVDLYPLMCSILALKPLPNN 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6790NP_650087.2 GPI_EPT_1 83..331 CDD:293744 65/403 (16%)
PigN 418..821 CDD:282796
enpp5XP_005160520.3 Enpp 71..422 CDD:293742 63/399 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.