Sequence 1: | NP_650087.2 | Gene: | CG6790 / 41388 | FlyBaseID: | FBgn0037915 | Length: | 897 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005160520.3 | Gene: | enpp5 / 563498 | ZFINID: | ZDB-GENE-041014-10 | Length: | 512 | Species: | Danio rerio |
Alignment Length: | 437 | Identity: | 75/437 - (17%) |
---|---|---|---|
Similarity: | 115/437 - (26%) | Gaps: | 210/437 - (48%) |
- Green bases have known domain annotations that are detailed below.
Fly 49 LVHLLLLICIMRIFYQSGPLSQLEPQKTLLDMGVPPAADRLVVFLLEGLRADTLFSDNCSGAVYI 113
Fly 114 RDI-------ILRQG-LVGISKTSVPTLTRSAEVALFAGFN-PMPSILPTSNFDTIFNRTLAFD- 168
Fly 169 ---------KGAFLRFSHLSDLRRRLTKRACLEKLWYANKLVMLVNLAEVGGASPLDIGFQMKLH 224
Fly 225 NTQRNIRDAYE--------------------------------------LIEATFND-------- 243
Fly 244 ---SKTAYLY-------TSAHGLTYFGSHG----------------------------GGSDEE- 269
Fly 270 -----------------------------REAPFLL-----WGAGVKHVTENITSDFVL-NNGVG 299
Fly 300 MQLHKLD--------------------QIQLAPLMSALIGLPPPVNN 326 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6790 | NP_650087.2 | GPI_EPT_1 | 83..331 | CDD:293744 | 65/403 (16%) |
PigN | 418..821 | CDD:282796 | |||
enpp5 | XP_005160520.3 | Enpp | 71..422 | CDD:293742 | 63/399 (16%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1524 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |