DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6790 and enpp7.1

DIOPT Version :9

Sequence 1:NP_650087.2 Gene:CG6790 / 41388 FlyBaseID:FBgn0037915 Length:897 Species:Drosophila melanogaster
Sequence 2:NP_001243734.1 Gene:enpp7.1 / 557756 ZFINID:ZDB-GENE-040724-13 Length:485 Species:Danio rerio


Alignment Length:168 Identity:33/168 - (19%)
Similarity:57/168 - (33%) Gaps:55/168 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 LAEVGGASPLDIGFQM-----------------KLHNTQRNIRDAYELIEATFNDSKTAYLYTSA 253
            |.::.|.|..|:.|.|                 |::|.   ::..:..:.....:...|.|:.|.
Zfish   262 LTDIPGFSLKDLKFHMVDYGPFGMLLPKEGMLDKVYNA---LKGGHPHLNVYKKEDMPARLHYSK 323

  Fly   254 H-----------------GLTYF----GSHGGGSDEEREAPFLLWGAGVKHVTENITSDFVLNNG 297
            |                 |...|    |.||..::.....||.          ..:..||..|..
Zfish   324 HPRLLPIILYADPGYVINGFYVFQNNKGEHGYDNEVMDMKPFF----------RAVGPDFHRNLL 378

  Fly   298 VGMQLHKLDQIQLAPLMSALIGLPPPVNNLAILPQGYM 335
            ||    ..:.:.:.|||..|||:.|.:|:.:::...:|
Zfish   379 VG----PFETVNVYPLMCHLIGIRPEINDGSLVNTRHM 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6790NP_650087.2 GPI_EPT_1 83..331 CDD:293744 32/162 (20%)
PigN 418..821 CDD:282796
enpp7.1NP_001243734.1 Enpp 29..396 CDD:293742 28/150 (19%)
Phosphodiest 31..356 CDD:279931 17/96 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.