DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6790 and enpp7.1

DIOPT Version :10

Sequence 1:NP_650087.2 Gene:CG6790 / 41388 FlyBaseID:FBgn0037915 Length:897 Species:Drosophila melanogaster
Sequence 2:NP_001243734.1 Gene:enpp7.1 / 557756 ZFINID:ZDB-GENE-040724-13 Length:485 Species:Danio rerio


Alignment Length:168 Identity:33/168 - (19%)
Similarity:57/168 - (33%) Gaps:55/168 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 LAEVGGASPLDIGFQM-----------------KLHNTQRNIRDAYELIEATFNDSKTAYLYTSA 253
            |.::.|.|..|:.|.|                 |::|.   ::..:..:.....:...|.|:.|.
Zfish   262 LTDIPGFSLKDLKFHMVDYGPFGMLLPKEGMLDKVYNA---LKGGHPHLNVYKKEDMPARLHYSK 323

  Fly   254 H-----------------GLTYF----GSHGGGSDEEREAPFLLWGAGVKHVTENITSDFVLNNG 297
            |                 |...|    |.||..::.....||.          ..:..||..|..
Zfish   324 HPRLLPIILYADPGYVINGFYVFQNNKGEHGYDNEVMDMKPFF----------RAVGPDFHRNLL 378

  Fly   298 VGMQLHKLDQIQLAPLMSALIGLPPPVNNLAILPQGYM 335
            ||    ..:.:.:.|||..|||:.|.:|:.:::...:|
Zfish   379 VG----PFETVNVYPLMCHLIGIRPEINDGSLVNTRHM 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6790NP_650087.2 GPI_EPT_1 83..331 CDD:293744 32/162 (20%)
PigN 418..821 CDD:461508
enpp7.1NP_001243734.1 Enpp 29..396 CDD:293742 28/150 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.