DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6790 and Enpp3

DIOPT Version :9

Sequence 1:NP_650087.2 Gene:CG6790 / 41388 FlyBaseID:FBgn0037915 Length:897 Species:Drosophila melanogaster
Sequence 2:NP_062243.2 Gene:Enpp3 / 54410 RGDID:708511 Length:875 Species:Rattus norvegicus


Alignment Length:354 Identity:70/354 - (19%)
Similarity:115/354 - (32%) Gaps:124/354 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TFLWCFFSVVVNVSFV-LYRRLT------YRLVGKVQVLMELWKSKVVLVHLLLLICIMRIFYQS 65
            ::.|....|.||.||. :||..:      .|:...:|.| :|.|::....:.:.:.......::|
  Rat   269 SYYWPGSDVAVNGSFPNIYRNYSNSVPYESRIATLLQWL-DLPKAERPSFYTIYVEEPDSAGHKS 332

  Fly    66 GPLSQLEPQKTLLDMGVPPA---ADRLVVFLLEGLRADTLFSDNCSGAVYIRDIILRQGLVGISK 127
            ||:|          .||..|   .|.....|:|||:...|  .||...:.:.|       .|:.:
  Rat   333 GPVS----------AGVIKALQLVDDAFGMLMEGLKQRNL--HNCVNIIVLAD-------HGMDQ 378

  Fly   128 TSVPTLTRSA----EVALFAGFNPMPSI----LPTSNFDTIFNRTLAFDKGAFLRFSHLS----- 179
            ||...:....    |:..:....|.|.|    :| .:|.|..:..:..|........|..     
  Rat   379 TSCDRVEYMTDYFPEINFYMYQGPAPRIRTRNIP-QDFFTFNSEEIVRDLSCRKSDQHFKPYLTP 442

  Fly   180 DLRRRL--TKRACLEKL-------W--YANKLVMLVNLAEVGGASPLDIGFQMKLHNTQRNIRDA 233
            ||.:||  .|...::|:       |  |.||           |:|                    
  Rat   443 DLPKRLHYAKNVRIDKVHLMVDRQWLAYRNK-----------GSS-------------------- 476

  Fly   234 YELIEATFNDSKTAYLYTSAHGLTYFGSHGGGSD-EEREAPFLLWGAGVKHVTENITSDFVLNNG 297
                              :..|    |:||..:: :..||.||..|...|..|            
  Rat   477 ------------------NCEG----GTHGYNNEFKSMEAIFLAHGPSFKEKT------------ 507

  Fly   298 VGMQLHKLDQIQLAPLMSALIGLPPPVNN 326
               .:...:.|::..|:..|:.:.|..||
  Rat   508 ---VIEPFENIEVYNLLCDLLHIQPAPNN 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6790NP_650087.2 GPI_EPT_1 83..331 CDD:293744 51/272 (19%)
PigN 418..821 CDD:282796
Enpp3NP_062243.2 SO 51..94 CDD:197571
Cell attachment site. /evidence=ECO:0000255 79..81
SO 95..138 CDD:197571
Phosphodiesterase 141..510 64/329 (19%)
Phosphodiest 162..486 CDD:396300 57/290 (20%)
Nuclease 605..875
NUC 608..867 CDD:238043
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.