DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6790 and Enpp5

DIOPT Version :9

Sequence 1:NP_650087.2 Gene:CG6790 / 41388 FlyBaseID:FBgn0037915 Length:897 Species:Drosophila melanogaster
Sequence 2:NP_001012762.1 Gene:Enpp5 / 316249 RGDID:1359199 Length:477 Species:Rattus norvegicus


Alignment Length:450 Identity:96/450 - (21%)
Similarity:154/450 - (34%) Gaps:127/450 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 VLVHLLLLICIMRIFYQSGPLS-QLEPQKTLLDMGVPPAADRLVVFLLEGLRADTLFSDNCSGAV 111
            ::...|::.|.:.....|.||| |.|.||.|             |...:|.|.|.|:........
  Rat     1 MIPEFLVVSCTLAALCHSVPLSLQTEQQKVL-------------VVSFDGFRWDYLYKVPTPHFH 52

  Fly   112 YIRDIILRQGLVGISKTSV-PTLTRSAEVALFAG-FNPMPSILPTSNFDTIFNRTLAFDKGAFLR 174
            |    :::.|:.....|:| .|.|......|..| |.....|:....||.:.|::.:.:      
  Rat    53 Y----VMKNGVHVKQVTNVFITKTYPNHYTLVTGLFAENHGIVANDMFDPVLNKSFSLE------ 107

  Fly   175 FSHLSDLRRRLTKRACLEKLWYANKLVMLVNLAEVGGASPLDI--GFQMKLHNTQRNIRDAYELI 237
              |::....:..:.|  ..||..|:        ..|.||...:  |..:|:|       ::|...
  Rat   108 --HMNIYDSKFWEEA--TPLWITNQ--------RAGHASGAAMWPGTDVKIH-------ESYPTH 153

  Fly   238 EATFNDS--------KTAYLYTSAH----GLTYF-----GSHGGGSDEEREAPFL---------- 275
            ...:|:|        |....:|:..    |..|:     ..|..|.|.....|.:          
  Rat   154 YLPYNESVSFEDRVAKIIEWFTAKDPINLGFLYWEEPDDTGHDVGPDSPLMGPVISDIDHKLGYL 218

  Fly   276 --------LWGAGVKHVTENITSDFVLNNGVGMQLHKLDQIQLAPLMSALIGLPPPVNNLAILP- 331
                    ||    .::...:|||..:......::.:||| .|......||...|..   |||| 
  Rat   219 IKMLKKAKLW----NNINLIVTSDHGMTQCSKERVIELDQ-YLDKEHYTLIDHSPVA---AILPK 275

  Fly   332 QGYMKVSREY-ARKSVHLNALQLLTQAKAIIRLHERGVFHKWLPKDKDLDLQQI------AYY-- 387
            :|  |.:..| |..:.|.|    ||..|      :..:..:|..|..| .:|.|      .:|  
  Rat   276 EG--KFNEVYDALANAHPN----LTVYK------KEEIPERWHYKHSD-RVQPIVAVADEGWYIL 327

  Fly   388 QNQMDHLL--DMGWRSKALETSTLAI-----------KVALKSLKFYHNYYHIPLVVTTV 434
            ||:.|..|  :.|:.:...|...:.:           |.|:.|...|....|: |.||.:
  Rat   328 QNKSDEFLLGNHGYDNALAEMHPIFLAHGPAFRKNFTKEAMNSTDLYSLVCHL-LNVTAL 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6790NP_650087.2 GPI_EPT_1 83..331 CDD:293744 54/286 (19%)
PigN 418..821 CDD:282796 5/16 (31%)
Enpp5NP_001012762.1 Enpp 28..382 CDD:293742 85/417 (20%)
Phosphodiest 30..342 CDD:279931 77/374 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.