DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6790 and Enpp4

DIOPT Version :9

Sequence 1:NP_650087.2 Gene:CG6790 / 41388 FlyBaseID:FBgn0037915 Length:897 Species:Drosophila melanogaster
Sequence 2:XP_006244660.1 Gene:Enpp4 / 301261 RGDID:1308689 Length:605 Species:Rattus norvegicus


Alignment Length:341 Identity:56/341 - (16%)
Similarity:107/341 - (31%) Gaps:145/341 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 YQSGPLSQLEPQKTLLDMGVPPAADRLVVFLLEGLRADTLF--------SDN----CS--GAVYI 113
            ::.||..:...::.|.::      |.|:..|::.|:|..|:        ||:    ||  ..:|:
  Rat   344 HKYGPEDKFNMRRVLKEV------DGLIGDLVQKLKALGLWESLNVIITSDHGMAQCSENRRIYL 402

  Fly   114 RDIILRQGLVGISKTSVPTLTRSAEVALFAGFNPMPSILPTSNFDTIFNRTLAFDKGAFLRFSHL 178
                  ...:..|..||..||            |:.:|||..|...::|           :..|.
  Rat   403 ------DTCINHSDYSVIDLT------------PVAAILPKINVTEVYN-----------KLKHC 438

  Fly   179 SDLRRRLTKRACLEKLWYAN----KLVMLVNLAEVGGASPLDIGFQMKLHNTQRNIRD-AYELIE 238
            :.......|.|...:.:|.:    :.::||          .|.|:.:.|:.:...:.| .|:   
  Rat   439 NPHMTVYLKEAIPNRFYYQHSDRIQPILLV----------ADEGWTIALNTSSSKLGDHGYD--- 490

  Fly   239 ATFNDSKTAYLYTSAHGLTYFGSHGGGSDEEREAPFLLWGAGVKHVTENITSDFVLNNGVGMQLH 303
               |...:.:.:.:|||..:           |:                           |.:..
  Rat   491 ---NSLPSMHPFLAAHGPAF-----------RK---------------------------GYRQS 514

  Fly   304 KLDQIQLAPLMSALIGLPPPVNN-------------------------------------LAILP 331
            .::.:.:.|:|..::||.|..||                                     |.|..
  Rat   515 TINTVDIYPMMCYILGLKPHPNNGTFSHSKCLLVDQWCINLPEAIGIVVSALLALTVLTGLIIFM 579

  Fly   332 QGYMKVSREYARKSVH 347
            |.....||.::|..:|
  Rat   580 QNRASASRPFSRLQLH 595

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6790NP_650087.2 GPI_EPT_1 83..331 CDD:293744 48/303 (16%)
PigN 418..821 CDD:282796
Enpp4XP_006244660.1 Enpp 177..530 CDD:293742 44/274 (16%)
Phosphodiest 179..490 CDD:279931 35/190 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.