DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6790 and ENPP4

DIOPT Version :9

Sequence 1:NP_650087.2 Gene:CG6790 / 41388 FlyBaseID:FBgn0037915 Length:897 Species:Drosophila melanogaster
Sequence 2:NP_055751.1 Gene:ENPP4 / 22875 HGNCID:3359 Length:453 Species:Homo sapiens


Alignment Length:167 Identity:34/167 - (20%)
Similarity:59/167 - (35%) Gaps:50/167 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 RRLTKRACLEKLWYANKLVMLVNLAEVGGASP----LDIGFQMKLHNTQRNI------------- 230
            |.:...:|::..:|.     |::|:.|....|    .::..::|..:...|:             
Human   247 RLINLDSCIDHSYYT-----LIDLSPVAAILPKINRTEVYNKLKNCSPHMNVYLKEDIPNRFYYQ 306

  Fly   231 -RDAYELIEATFNDSKTAYLYTSAHGLTYFGSHGGGSDEEREAPFL-----LWGAGVKHVTENIT 289
             .|..:.|....::..|..|..|:..|   |.||..:......|||     .:..|.||.|.|| 
Human   307 HNDRIQPIILVADEGWTIVLNESSQKL---GDHGYDNSLPSMHPFLAAHGPAFHKGYKHSTINI- 367

  Fly   290 SDFVLNNGVGMQLHKLDQIQLAPLMSALIGLPPPVNN 326
                              :.:.|:|..::||.|..||
Human   368 ------------------VDIYPMMCHILGLKPHPNN 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6790NP_650087.2 GPI_EPT_1 83..331 CDD:293744 34/167 (20%)
PigN 418..821 CDD:282796
ENPP4NP_055751.1 Enpp 26..379 CDD:293742 29/158 (18%)
Phosphodiest 28..339 CDD:279931 18/99 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.