DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6790 and Enpp4

DIOPT Version :9

Sequence 1:NP_650087.2 Gene:CG6790 / 41388 FlyBaseID:FBgn0037915 Length:897 Species:Drosophila melanogaster
Sequence 2:XP_006524196.1 Gene:Enpp4 / 224794 MGIID:2682634 Length:470 Species:Mus musculus


Alignment Length:483 Identity:91/483 - (18%)
Similarity:156/483 - (32%) Gaps:160/483 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 AADRLVVFLLEGLRADTLFSDNCSGAVYIRDIILRQGLVGISKTSVPTLTRSAEVALFAG-FNPM 148
            :|.||::...:|.|||.|.|.:..   ::::.|....||...|....|.|.....::..| :...
Mouse    41 SAPRLLLVSFDGFRADYLKSYDLP---HLQNFIKEGVLVEHVKNVFITKTFPNHYSIVTGLYEES 102

  Fly   149 PSILPTSNFDTIFNRTLAFDKGAFLRFSHLSDLRRRLTKRACLEKLWYANKLVMLVNLAEVGGAS 213
            ..|:..|.:|::..:          .||..:|........|  |.:|..|:|  ..|.:......
Mouse   103 HGIVANSMYDSVTKK----------HFSESNDKDPFWWNGA--EPIWVTNQL--QENRSSAAAMW 153

  Fly   214 PLDIGFQMKLHNTQRNIRDAYELIEATFND---SKTAYLYTSAHGLTY----------FGSHGGG 265
            |   |..:.:||...:....|. ...:|.:   :.|.:|.:|...:|:          .|...|.
Mouse   154 P---GTDVPIHNITASYFMNYS-SSVSFKERLGNVTTWLSSSNPPVTFAALYWEEPDVSGHKYGP 214

  Fly   266 SDEEREAPFL------------------LWGAGVKHVTENITSDFVLNNGVGMQLHKLDQ----- 307
            .|:|.....|                  ||.:    :...||||..:......:|..||.     
Mouse   215 EDKENMRRVLKEVDDLIGDIVLKLKVLGLWDS----LNVIITSDHGMAQCSKNRLIDLDSCIDRS 275

  Fly   308 ----IQLAPLMSALIGLPPPVNNLAILPQGYMKVSREYARKSVHLNA-------LQLLTQAKAII 361
                |.|.|:.:.|    |.:|    :.:.|.|:.|.....:|:|..       .|..::.:.||
Mouse   276 NYSVIDLTPVAAIL----PKIN----VTEVYDKLKRCNPHMNVYLKEAIPNRFYYQHSSRIQPII 332

  Fly   362 RLHERGVFHKWLPKDKDLDLQQIAY------YQNQMDHL----------LDMGWRSKALETSTLA 410
            .:.|.|    |     .:.|.:.::      |.|.:..:          ...|:|...:.|    
Mouse   333 LVAEEG----W-----TITLNKSSFKLGDHGYDNSLPSMHPFLAAHGPAFRKGYRQSTINT---- 384

  Fly   411 IKVALKSLKFYHNYYHIPLVVTTVLALLGWQFYQLVKLSQNVMAPHYMRRGYLT---------WC 466
                   :..|....||          ||             :.|| ...|.|:         ||
Mouse   385 -------VDIYPMMCHI----------LG-------------LKPH-PNNGTLSHTKCLLVDQWC 418

  Fly   467 TIFLASLG----------LLLGEMVFLQ 484
            .....::|          :|.|.|:|::
Mouse   419 INLPEAIGIVVSALLVLTMLTGLMIFMR 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6790NP_650087.2 GPI_EPT_1 83..331 CDD:293744 58/286 (20%)
PigN 418..821 CDD:282796 16/86 (19%)
Enpp4XP_006524196.1 Enpp 43..396 CDD:293742 77/415 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.