DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG6790 and Enpp3

DIOPT Version :9

Sequence 1:	NP_650087.2	Gene:	CG6790 / 41388	FlyBaseID:	FBgn0037915	Length:	897	Species:	Drosophila melanogaster
Sequence 2:	NP_598766.2	Gene:	Enpp3 / 209558	MGIID:	2143702	Length:	874	Species:	Mus musculus

Alignment Length:	135	Identity:	32/135 - (23%)
Similarity:	45/135 - (33%)	Gaps:	44/135 - (32%)

- Green bases have known domain annotations that are detailed below.

  Fly    23 VLYRRLTYRLVGKVQVLMELWKSKVVLVHLLLLICIMRIFYQSGPLSQLEPQKTLLDMGVPPAAD 87
            :||.|......||. :.|.:|.|..||              :.|..|.|.|.       ||
Mouse   624 LLYHRDYISGYGKA-MKMPMWSSYTVL--------------KPGDTSSLPPT-------VP---- 662

  Fly    88 RLVVFLLEGLRADTLF----SDNCSGAVYIRDIILRQGLV-----GISKTSVPTLTRSAEVALFA 143
                   :.||||...    |..||  .|:.|..:..|.:     |.:::....|..|..|.::.
Mouse   663 -------DCLRADVRVAPSESQKCS--FYLADKNITHGFLYPAIKGTNESRYDALITSNLVPMYK 718

  Fly   144 GFNPM 148
            .|..|
Mouse   719 EFKKM 723

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG6790	NP_650087.2	GPI_EPT_1	83..331	CDD:293744	17/75 (23%)
CG6790	NP_650087.2	PigN	418..821	CDD:282796
Enpp3	NP_598766.2	SO	50..93	CDD:197571
		Cell attachment site. /evidence=ECO:0000255	78..80
		SO	94..137	CDD:197571
		Phosphodiesterase	140..509
		Enpp	159..525	CDD:293742
		Phosphodiest	161..485	CDD:279931
		Nuclease	605..874		32/135 (24%)
		NUC	627..856	CDD:214683	30/132 (23%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG1524
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900