DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6790 and Enpp3

DIOPT Version :10

Sequence 1:NP_650087.2 Gene:CG6790 / 41388 FlyBaseID:FBgn0037915 Length:897 Species:Drosophila melanogaster
Sequence 2:NP_598766.2 Gene:Enpp3 / 209558 MGIID:2143702 Length:874 Species:Mus musculus


Alignment Length:135 Identity:32/135 - (23%)
Similarity:45/135 - (33%) Gaps:44/135 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VLYRRLTYRLVGKVQVLMELWKSKVVLVHLLLLICIMRIFYQSGPLSQLEPQKTLLDMGVPPAAD 87
            :||.|......||. :.|.:|.|..||              :.|..|.|.|.       ||    
Mouse   624 LLYHRDYISGYGKA-MKMPMWSSYTVL--------------KPGDTSSLPPT-------VP---- 662

  Fly    88 RLVVFLLEGLRADTLF----SDNCSGAVYIRDIILRQGLV-----GISKTSVPTLTRSAEVALFA 143
                   :.||||...    |..||  .|:.|..:..|.:     |.:::....|..|..|.::.
Mouse   663 -------DCLRADVRVAPSESQKCS--FYLADKNITHGFLYPAIKGTNESRYDALITSNLVPMYK 718

  Fly   144 GFNPM 148
            .|..|
Mouse   719 EFKKM 723

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6790NP_650087.2 GPI_EPT_1 83..331 CDD:293744 17/75 (23%)
PigN 418..821 CDD:461508
Enpp3NP_598766.2 SO 50..93 CDD:197571
Cell attachment site. /evidence=ECO:0000255 78..80
SO 94..137 CDD:197571
Phosphodiesterase. /evidence=ECO:0000250|UniProtKB:O14638 160..544
Phosphodiest 161..485 CDD:396300
Nuclease. /evidence=ECO:0000250|UniProtKB:O14638 581..874 32/135 (24%)
NUC 627..856 CDD:214683 30/132 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.