DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6790 and Enpp2

DIOPT Version :9

Sequence 1:NP_650087.2 Gene:CG6790 / 41388 FlyBaseID:FBgn0037915 Length:897 Species:Drosophila melanogaster
Sequence 2:XP_036015136.1 Gene:Enpp2 / 18606 MGIID:1321390 Length:1001 Species:Mus musculus


Alignment Length:325 Identity:68/325 - (20%)
Similarity:109/325 - (33%) Gaps:111/325 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 DRLVVFLLEGLRADTLFSDNCSGAVYIRDIILRQGL--VGISKTSVPT--LTRSAEVALFAG--- 144
            |:.|..|::||:  .|....|...:::.|    .|:  |...:|...:  ||...::.|..|   
Mouse   446 DKTVGQLMDGLK--QLKLHRCVNVIFVGD----HGMEDVTCDRTEFLSNYLTNVDDITLVPGTLG 504

  Fly   145 -FNP-MPSILPTSNFDTIFNRTLAFDKGAFLRFSHLSDLRRRLTKRACLEKLWYANKLVMLVNLA 207
             ..| :|:.|.......|.|.|.......|..:     :::.|.||     |.|||         
Mouse   505 RIRPKIPNNLKYDPKAIIANLTCKKPDQHFKPY-----MKQHLPKR-----LHYAN--------- 550

  Fly   208 EVGGASPLDIGFQMKLHNTQRNIRDAYELIEATFNDS-KTAYLYTSAHGLTYF-GSHG-GGSDEE 269
                               .|.|.|.:.|:|..::.: |...:|....|..:| |.|| ......
Mouse   551 -------------------NRRIEDLHLLVERRWHVARKPLDVYKKPSGKCFFQGDHGFDNKVNS 596

  Fly   270 REAPFLLWGAGVKHVTENITSDFVLNNGVGMQLHKLDQIQLAPLMSALIGLPPPVNN-------- 326
            .:..|:.:|...|:.|               ::...:.|:|..:|..|:||.|..||        
Mouse   597 MQTVFVGYGPTFKYRT---------------KVPPFENIELYNVMCDLLGLKPAPNNGTHGSLNH 646

  Fly   327 -------LAILPQGYMKVSRE------YARKSVHL-----------NALQLLTQAKAIIRLHERG 367
                   ...||:   :|||.      |.:....|           |.|:.|.:     |||.:|
Mouse   647 LLRTNTFRPTLPE---EVSRPNYPGIMYLQSDFDLGCTCDDKVEPKNKLEELNK-----RLHTKG 703

  Fly   368  367
            Mouse   704  703

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6790NP_650087.2 GPI_EPT_1 83..331 CDD:293744 54/270 (20%)
PigN 418..821 CDD:282796
Enpp2XP_036015136.1 SO 118..159 CDD:197571
SO 160..203 CDD:197571
Phosphodiest 227..591 CDD:396300 41/188 (22%)
NUC 753..983 CDD:214683
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.