DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6790 and C01B10.9

DIOPT Version :9

Sequence 1:NP_650087.2 Gene:CG6790 / 41388 FlyBaseID:FBgn0037915 Length:897 Species:Drosophila melanogaster
Sequence 2:NP_501023.3 Gene:C01B10.9 / 177430 WormBaseID:WBGene00015283 Length:555 Species:Caenorhabditis elegans


Alignment Length:211 Identity:36/211 - (17%)
Similarity:74/211 - (35%) Gaps:80/211 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 FDKGAFLRFSHLSDLRRRLTKRACLEKLWYANKLVMLVNLAEVGGASPLDIGFQMKLH------- 224
            |:.|..:.:.|..::.:::          ||| |...|.          :.|:.:.:|       
 Worm   273 FEMGDHMIYPHSDEIGKQI----------YAN-LTSAVK----------EHGYDVNIHWREEVPE 316

  Fly   225 -----NTQRNIRDAYE--------------LIEATFNDSKTAYLYTSAHGLTYFGSHGGGSDEER 270
                 |:.|..:..:|              |:|..:.::.|....:|.|          |.|.:|
 Worm   317 RWHYRNSSRIGKIVFEPQIGSSISFSCTKDLMEKQYGENGTLKFNSSTH----------GQDPDR 371

  Fly   271 ---EAPFLLWGAGVKHVTENITSDFVLNNGVGMQLHKLDQIQLAPLMSALIGLPPPVNNLAILPQ 332
               .|..::.|..   .:||.|...:.:|           :.|..:|..::|:.|..||      
 Worm   372 PEMRAFLIMRGPA---FSENYTIADIPSN-----------VDLYNIMCHVLGITPTENN------ 416

  Fly   333 GYMKVSREYARKSVHL 348
            |.|::.:...:::.:|
 Worm   417 GTMEIVKRALKENRYL 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6790NP_650087.2 GPI_EPT_1 83..331 CDD:293744 33/192 (17%)
PigN 418..821 CDD:282796
C01B10.9NP_501023.3 Enpp 23..409 CDD:293742 29/180 (16%)
Phosphodiest 25..368 CDD:279931 19/125 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.