DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mrp4 and Abcb10

DIOPT Version :9

Sequence 1:NP_650086.2 Gene:Mrp4 / 41387 FlyBaseID:FBgn0263316 Length:1316 Species:Drosophila melanogaster
Sequence 2:NP_062425.1 Gene:Abcb10 / 56199 MGIID:1860508 Length:715 Species:Mus musculus


Alignment Length:599 Identity:147/599 - (24%)
Similarity:248/599 - (41%) Gaps:117/599 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   739 FLCLATQILCSAADYFLSYWVDKNVDGQTDINTDPQDMYYFAALNVAVVVFTI---------VRT 794
            ||.::: ::..:|.:||...:|.       |.|:|.:.|..:...:..|:..:         :|.
Mouse   142 FLAVSS-VITMSAPFFLGRIIDV-------IYTNPSEGYGDSLTRLCAVLTCVFLCGAAANGIRV 198

  Fly   795 MLFYKMAMRSSTQLHNAMYQGITRAAMYFFNTNPSGRILNRFSKDLGQLDEVLPSVMLD------ 853
            .|..........:|..:::..|.|..:.||:...:|.::||.|.|...|...:...:.|      
Mouse   199 YLMQSSGQSIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRSVTENLSDGLRAGA 263

  Fly   854 -----VVQLFLTLLGIIV-VICITNPYYLILTLALAIIF-YYIREFYLKTSRDVKRLEAVARSPI 911
                 |..:|.....:.. |:.:..|..:     ||:|: .|:|:....|...:.....:|..  
Mouse   264 QASVGVGMMFFVSPSLATFVLSVVPPISV-----LAVIYGRYLRKLSKATQDSLAEATQLAEE-- 321

  Fly   912 YSHLSATITGLPTIRALG-------------------AQKELIAEFDNLQDLHSSGYY--TFLAT 955
                  .|..:.||||.|                   ||||.:|.         :|::  ..|:.
Mouse   322 ------RIGNIRTIRAFGKEMTEVEKYTGRVDQLLQLAQKEALAR---------AGFFGAAGLSG 371

  Fly   956 NRAFGYYLDCFCTLYIVIIILNYFINPPQSPGE----------VGLAITQAMGMTGMVQWAMRQS 1010
            |      |.....||...:::.   :...:.||          |||:|.   |::...       
Mouse   372 N------LIVLSVLYKGGLLMG---SAHMTVGELSSFLMYAFWVGLSIG---GLSSFY------- 417

  Fly  1011 AELENTMTAVERVVEYDEIEPEGEFDSREGKKPSPSWPEK---GEIIAEDLCLRYFPDPQAKYVL 1072
            :||...:.|..|:.|..|.:|...|:  ||.    ...||   |.:...::...|...|:.. |.
Mouse   418 SELMKGLGAGGRLWELLERQPRLPFN--EGM----VLDEKTFQGALEFRNVHFTYPARPEVS-VF 475

  Fly  1073 KALNFRIRPCEKVGIVGRTGAGKSSLINALFRL-SYNEGIITIDERDTADMGLFDLRSKISIIPQ 1136
            :..:..|.......:||.:|:|||::::.|.|| ..|.|.:::|..|...:....|||||..:.|
Mouse   476 QDFSLSIPSGSVTALVGPSGSGKSTVVSLLLRLYDPNSGTVSLDGHDIRQLNPVWLRSKIGTVSQ 540

  Fly  1137 EPVLFSGS----MRYNLDPFEEYNDAKLWDALEEVKLKPLISELPNGLQSKISEGGSNFSVGQRQ 1197
            ||||||.|    :.|..|........::..|.|.......|...|.|..:.:.|.|...|.||:|
Mouse   541 EPVLFSCSVAENIAYGADNLSSVTAQQVERAAEVANAAEFIRSFPQGFDTVVGEKGILLSGGQKQ 605

  Fly  1198 LVCLARAILRENRVLVMDEATANVDPQTDALIQATIRSKFRDCTVLTIAHRLNTIMDSDRVLVMD 1262
            .:.:|||:|:..::|::||||:.:|.:.:.|:|..:.......|||.|||||:||.:::.|.|:|
Mouse   606 RIAIARALLKNPKILLLDEATSALDAENEHLVQEALDRLMEGRTVLIIAHRLSTIKNANFVAVLD 670

  Fly  1263 AGHLVEFGSPYELL 1276
            .|.:.|.|:..|||
Mouse   671 HGKICEHGTHEELL 684

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mrp4NP_650086.2 CFTR_protein 12..1277 CDD:273530 147/599 (25%)
ABC_membrane 93..359 CDD:294371
ABCC_MRP_domain1 422..622 CDD:213217
ABC_membrane 735..978 CDD:294371 53/281 (19%)
ABCC_MRP_domain2 1051..1272 CDD:213211 72/225 (32%)
Abcb10NP_062425.1 3a01208 8..694 CDD:273363 147/599 (25%)
ABC_membrane 142..403 CDD:279056 55/299 (18%)
ABC_MTABC3_MDL1_MDL2 458..698 CDD:213216 74/228 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.