DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10898 and NUDT7

DIOPT Version :10

Sequence 1:NP_650083.1 Gene:CG10898 / 41384 FlyBaseID:FBgn0037911 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001190707.1 Gene:NUDT7 / 826884 AraportID:AT4G12720 Length:322 Species:Arabidopsis thaliana


Alignment Length:172 Identity:40/172 - (23%)
Similarity:58/172 - (33%) Gaps:65/172 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SSASDFVPILGQTVTYIVACVLINEHDELLMIEEAKQSCAGK--WYLPAG--------------- 91
            |...|.:|.....|....|.|:.....|:|:::|.......|  |.||.|               
plant    90 SETPDTIPANASHVVGAGALVINKNTKEVLVVQERSGFFKDKNVWKLPTGVINEELVVLRVVGEL 154

  Fly    92 ---------------------------RMERGESITEAAAREVFEETGLNAELTTLLA------- 122
                                       ||  ||.|....||||.||||:.|:...:||       
plant   155 HKKVVLTSYRSIKCLLIICNDTKNETKRM--GEDIWTGVAREVEEETGIIADFVEVLAFRQSHKA 217

  Fly   123 -VEAAGGSWFRFVLTGR---ITGGRLKTPADADAESIQARWV 160
             ::.....:|..||:.|   ||        :..:|.:||:|:
plant   218 ILKKKTDMFFLCVLSPRSYDIT--------EQKSEILQAKWM 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10898NP_650083.1 NUDIX_8DGDPP_Nudt18 59..187 CDD:467555 36/157 (23%)
NUDT7NP_001190707.1 Nudix_hydro 11..89 CDD:465697
NUDIX_ASFGF2_Nudt6 102..278 CDD:467554 37/160 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.