DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10898 and Nudt6

DIOPT Version :10

Sequence 1:NP_650083.1 Gene:CG10898 / 41384 FlyBaseID:FBgn0037911 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001277973.1 Gene:Nudt6 / 229228 MGIID:2387618 Length:313 Species:Mus musculus


Alignment Length:104 Identity:28/104 - (26%)
Similarity:47/104 - (45%) Gaps:4/104 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 VACVLINEHDELLMIEEAKQSCAGKWYLPAGRMERGESITEAAAREVFEETGLNAELTTLLAVEA 125
            ||..:.:.....:::.:.:......|..|.|..|.||.|.:.|.||||||||:.:|..:||::..
Mouse   143 VAGAVFDVSTRKVLVVQDRNKLKNMWKFPGGLSEPGEDIADTAVREVFEETGVKSEFRSLLSIRQ 207

  Fly   126 AGGSWFRFVLTGRITGGRLK----TPADADAESIQARWV 160
            ...|...|.::......||:    |......|.::..|:
Mouse   208 QHRSPGAFGMSDMYLVCRLQPRSFTINFCQQECLKCEWI 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10898NP_650083.1 NUDIX_8DGDPP_Nudt18 59..187 CDD:467555 28/104 (27%)
Nudt6NP_001277973.1 Nudix_hydro 43..126 CDD:465697
NUDIX_ASFGF2_Nudt6 139..270 CDD:467554 28/104 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.