DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14708 and CG15375

DIOPT Version :9

Sequence 1:NP_650082.1 Gene:CG14708 / 41383 FlyBaseID:FBgn0037910 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_572149.2 Gene:CG15375 / 31356 FlyBaseID:FBgn0029694 Length:233 Species:Drosophila melanogaster


Alignment Length:200 Identity:90/200 - (45%)
Similarity:120/200 - (60%) Gaps:40/200 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAEQHYNANDLASDPNSRKLKFAGICKLNNNELSSLYNIDKLTDEELASVNLDRSSLIDDYRLLH 65
            |.||  |.::..::|.||||||:|||||.:.|||.||.:|:|||||||||:|.||||||||||||
  Fly     1 MEEQ--NVDETKTNPLSRKLKFSGICKLTDEELSHLYKLDELTDEELASVDLKRSSLIDDYRLLH 63

  Fly    66 EVSQMKQIENEANNIP-------AAAPAGQPKSKELHEQFVKEMEKYLTNKKYTFPMLNHLIKLM 123
            |||.|:|:||||...|       ...|..:||:::                      |.|.:|:|
  Fly    64 EVSMMRQMENEAAKPPNPPEPPKPPNPPERPKARK----------------------LLHFVKVM 106

  Fly   124 SWEVEPETIFNEKAFQIDVNYHEDEEVMQLEPNERLFRRLKSIYDHLEDMFINGNRRTASDLVFT 188
            |:|.||.|||.|:..::|.||        :|.|..:| ||:|.|::|:.|:::||...|.|||..
  Fly   107 SFEEEPGTIFTEEQLRLDSNY--------MELNSDIF-RLESFYNYLDSMYVSGNSNRAIDLVMF 162

  Fly   189 AIIRL 193
            .|.||
  Fly   163 GIHRL 167



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450790
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019563
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.