DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and KIRREL3

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_011541328.1 Gene:KIRREL3 / 84623 HGNCID:23204 Length:809 Species:Homo sapiens


Alignment Length:266 Identity:60/266 - (22%)
Similarity:102/266 - (38%) Gaps:39/266 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 YFGHLAAAEELSNLIPDNYD-AIDPVFD---NTTDREVIAALGTTARLHCRVRHLGDRAVSWIRQ 127
            ||....:.|..:.|...|.. .:|..|.   .|..:.::..||:.|...|.........:.|:::
Human   313 YFSEPVSCEVTNALGSTNLSRTVDVYFGPRMTTEPQSLLVDLGSDAIFSCAWTGNPSLTIVWMKR 377

  Fly   128 RDLHILTIGIMTYTNDQRFLARHIDNSDEWVLKIVSVQQRDAGVYECQVSTEPKISLAYKLVVVT 192
            ....:|                    |:|..|.:.||:|.|||.|.|: :..|::....:.|.:|
Human   378 GSGVVL--------------------SNEKTLTLKSVRQEDAGKYVCR-AVVPRVGAGEREVTLT 421

  Fly   193 SKAQ--ILANRELFIQSGSDINLTCIAPQAPGPYTHMLWHKDTELVSDSARGGIRVE--SEQQMK 253
            ....  |.:.:......|....:.|.....|.| ..:.|.....::.....|...||  |.::..
Human   422 VNGPPIISSTQTQHALHGEKGQIKCFIRSTPPP-DRIAWSWKENVLESGTSGRYTVETISTEEGV 485

  Fly   254 TSNLVISRVQHTDSGN-YTCSADNS-NSDSVFVHIIKSEQHAAMQHELGSRLLLPPLPLLLLAVL 316
            .|.|.||.:...|... |.|:|.|| .||:..:.:  .||.:.|:.  |:.|....:|   :||:
Human   486 ISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRL--KEQGSEMKS--GAGLEAESVP---MAVI 543

  Fly   317 LVVLLG 322
            :.|.:|
Human   544 IGVAVG 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 20/95 (21%)
IG_like 98..179 CDD:214653 17/80 (21%)
IG_like 206..278 CDD:214653 19/75 (25%)
Ig 211..278 CDD:143165 18/70 (26%)
KIRREL3XP_011541328.1 Ig 58..149 CDD:299845
IG_like 60..149 CDD:214653
I-set 156..249 CDD:254352
Ig2_KIRREL3-like 171..252 CDD:143236
Ig_2 260..337 CDD:290606 5/23 (22%)
I-set 341..422 CDD:254352 20/101 (20%)
IGc2 355..406 CDD:197706 16/71 (23%)
Ig5_KIRREL3 424..521 CDD:143306 22/99 (22%)
IG_like 432..521 CDD:214653 21/91 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.