DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and DIP-epsilon

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster


Alignment Length:264 Identity:69/264 - (26%)
Similarity:113/264 - (42%) Gaps:27/264 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 MALLVIMGLTAPVDKQSRRSSQYFGHLAAAEELSNLIPDNYDAIDPVFDNTTDREVIAALGTTAR 109
            :..|:...:....|..|..::...|    ...|:|:|.:     ||.|.:..:...:.| |...:
  Fly    16 LGCLIASSVALSTDTGSEGNAGNVG----GSTLNNVISE-----DPEFTDVIENITVPA-GRNVK 70

  Fly   110 LHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTNDQRFLARHIDNSDE---WVLKIVSVQQRDAGV 171
            |.|.|::||...|:|:......|||:.....|.:.|....| |..|:   |.|.|.:||:.|.|.
  Fly    71 LACSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTH-DKHDKHRTWFLHINNVQEEDRGR 134

  Fly   172 YECQVST-EPKISLAY-KLVVVTSKAQILANRELFIQSGSDINLTCIAPQAPGPYTHMLWHKDTE 234
            |.||::| ..|....: |:||..:....|.:.::.::.|.::.|.|.|..:|.|  .:.|.:|  
  Fly   135 YMCQINTVTAKTQYGFVKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKGSPEP--TIKWKRD-- 195

  Fly   235 LVSDSARGGIRVESE-QQMKTSNLVISRVQHTDSGNYTCSADNSNSDSVFVHIIKSEQHAAM--- 295
               |..:..|....| ..::|.:|.:.|:.....|.|.|.|.|....||...|..|...:.|   
  Fly   196 ---DGNKIVINKTLEVHDLETDSLELERISRLHMGAYLCIASNGVPPSVSKRIKVSVDFSPMVWI 257

  Fly   296 QHEL 299
            .|:|
  Fly   258 PHQL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 31/100 (31%)
IG_like 98..179 CDD:214653 28/84 (33%)
IG_like 206..278 CDD:214653 19/72 (26%)
Ig 211..278 CDD:143165 18/67 (27%)
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 30/97 (31%)
Ig 69..139 CDD:143165 24/70 (34%)
IG_like 165..249 CDD:214653 22/90 (24%)
IGc2 172..237 CDD:197706 19/71 (27%)
IG_like 267..348 CDD:214653
Ig 270..339 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.