DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and Negr1

DIOPT Version :10

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_063138498.1 Gene:Negr1 / 59318 RGDID:708416 Length:423 Species:Rattus norvegicus


Alignment Length:191 Identity:54/191 - (28%)
Similarity:85/191 - (44%) Gaps:30/191 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 DNTTDREVIAALGTTARLHCRVRHLGDRAV--SWIRQRDLHILTIGIMTYTNDQRFLARHIDNSD 155
            ||...|:     |.||.|.|   :|.|.|.  :|:.:..  |:..|...::.|.|.....: |..
  Rat    40 DNMLVRK-----GDTAVLRC---YLEDGASKGAWLNRSS--IIFAGGDKWSVDPRVSISTL-NKR 93

  Fly   156 EWVLKIVSVQQRDAGVYECQVSTE--PKISLAYKLVVVTSKAQILANRELFIQSGSDINLTCIAP 218
            ::.|:|.:|...|.|.|.|.|.|:  |:....:..|.|..|...::| ::.|..|:::.|||:|.
  Rat    94 DYSLQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVPPKIYDISN-DMTINEGTNVTLTCLAT 157

  Fly   219 QAPGPYTHMLWHKDTELVSDSARGGIRVESEQQMKTSNLVISRVQHTDSGNYTCSADNSNS 279
            ..|.|  .:.|..    :|.||:   ..|:.|.     |.|..:....:|.|.|||:|..|
  Rat   158 GKPEP--AISWRH----ISPSAK---PFENGQY-----LDIYGITRDQAGEYECSAENDVS 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 FR1 96..113 CDD:409355 5/16 (31%)
IG_like 98..179 CDD:214653 23/82 (28%)
Ig strand A' 100..102 CDD:409355 0/1 (0%)
Ig strand B 106..114 CDD:409355 4/7 (57%)
CDR1 114..120 CDD:409355 1/5 (20%)
FR2 121..132 CDD:409355 2/12 (17%)
Ig strand C 121..127 CDD:409355 2/7 (29%)
Ig strand C' 130..133 CDD:409355 0/2 (0%)
CDR2 133..146 CDD:409355 2/12 (17%)
Ig strand D 146..151 CDD:409355 0/4 (0%)
FR3 147..176 CDD:409355 8/28 (29%)
Ig strand E 155..162 CDD:409355 1/6 (17%)
Ig strand F 170..177 CDD:409355 3/6 (50%)
IG_like 206..278 CDD:214653 21/71 (30%)
Ig strand B 211..215 CDD:409353 1/3 (33%)
Ig strand C 226..230 CDD:409353 0/3 (0%)
Ig strand E 255..259 CDD:409353 1/3 (33%)
Ig strand F 269..274 CDD:409353 2/4 (50%)
Negr1XP_063138498.1 None

Return to query results.
Submit another query.