DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and CADM3

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_024304528.1 Gene:CADM3 / 57863 HGNCID:17601 Length:481 Species:Homo sapiens


Alignment Length:285 Identity:69/285 - (24%)
Similarity:106/285 - (37%) Gaps:78/285 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 TTDREVIAALGTTARLHCRVRHLGDRAVSWIR--QRDLHILTIGIMTYTNDQRFLARHIDNSDEW 157
            |:|..|:|  |.|..|.|:|:...|.::.|..  |:.|         |..::|.|.   ||..:.
Human   118 TSDETVVA--GGTVVLKCQVKDHEDSSLQWSNPAQQTL---------YFGEKRALR---DNRIQL 168

  Fly   158 V--------LKIVSVQQRDAGVYECQVSTEPKISLAYKLVVVTSKAQ--ILANRELFIQSGSDIN 212
            |        :.|.:|...|.|.|.|.:.|.| :..|..||.|....|  |:...:..::......
Human   169 VTSTPHELSISISNVALADEGEYTCSIFTMP-VRTAKSLVTVLGIPQKPIITGYKSSLREKDTAT 232

  Fly   213 LTCIAPQAPG--PYTHMLWHK-DTELVSDSARGGIRVESEQQMKT---SNLVISRVQHTDSG-NY 270
            |.|   |:.|  |...:.|.| |.||..:..    |::.:...||   |:.|..:|...|.| :.
Human   233 LNC---QSSGSKPAARLTWRKGDQELHGEPT----RIQEDPNGKTFTVSSSVTFQVTREDDGASI 290

  Fly   271 TCS--------ADNSNSDSVFV-----HIIKSEQHAAMQHELGSRLLL----------------- 305
            .||        ||.|.|..:.|     .:|:.:.....:   |.:|||                 
Human   291 VCSVNHESLKGADRSTSQRIEVLYTPTAMIRPDPPHPRE---GQKLLLHCEGRGNPVPQQYLWEK 352

  Fly   306 ----PPLPLLLLAVLLVVLLGPTSS 326
                |||.:...:.|:...|..:.|
Human   353 EGSVPPLKMTQESALIFPFLNKSDS 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 30/105 (29%)
IG_like 98..179 CDD:214653 23/90 (26%)
IG_like 206..278 CDD:214653 22/86 (26%)
Ig 211..278 CDD:143165 22/81 (27%)
CADM3XP_024304528.1 Ig1_Necl-1 115..209 CDD:143290 30/105 (29%)
Ig2_Necl-1 230..312 CDD:143329 24/88 (27%)
IG_like 328..399 CDD:214653 10/53 (19%)
4.1m 437..452 CDD:128590
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5236
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.