DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and CG34353

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster


Alignment Length:271 Identity:64/271 - (23%)
Similarity:115/271 - (42%) Gaps:51/271 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ISNSRAPQIAHEMLVEYFMALLVIMGLTAPVDKQSRRSSQYFGHLAAAEELSNLIPDNYDAIDPV 91
            |.:.|...:.|.:    |:|:.|:              |.:|..::|    .:::..|    :|:
  Fly    49 IRDRRVGSLPHIL----FLAIAVV--------------SLHFESVSA----QSMMTKN----EPM 87

  Fly    92 FDNTTDREVIAALGTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTNDQRFLARHIDNSDE 156
            |.:.::...... |.|..|.|.|.:.....|:|  :|.:.|||.|.:..|.|.|  .|.::..: 
  Fly    88 FISRSETFKFIT-GETIVLPCEVANTDTYVVAW--KRGIAILTAGSVKVTPDPR--VRLVNGFN- 146

  Fly   157 WVLKIVSVQQRDAGVYECQVST-EPK-ISLAYKLVVVTSKAQILANRELFIQSGSDINLTCIAPQ 219
              |:|......|||.|.||::| :|: |:...:::|......|.....|.::.||.:.:.|.|..
  Fly   147 --LQIRDALPTDAGDYICQIATMDPREITHTVEILVPPRIHHISTGGHLQVKKGSSVRIECSATG 209

  Fly   220 APGPYTHMLWHKDTELVSDSARGGIRVESEQQMKTSNLVISRVQHTDSGNYTCSADN----SNSD 280
            .|.|  ::.|         |.:..|....|:::.:..|.|..|.....|.|.|:|:|    ..|.
  Fly   210 NPMP--NVTW---------SRKNNILPNGEEKLHSHVLSIENVDRHKGGVYICTANNRVGQPASS 263

  Fly   281 SVFVHIIKSEQ 291
            .|.:|::.|.:
  Fly   264 QVVLHVLFSPE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 27/97 (28%)
IG_like 98..179 CDD:214653 25/81 (31%)
IG_like 206..278 CDD:214653 18/75 (24%)
Ig 211..278 CDD:143165 16/70 (23%)
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 27/86 (31%)
Ig 103..177 CDD:143165 25/80 (31%)
IG_like 191..269 CDD:214653 21/88 (24%)
IGc2 198..258 CDD:197706 18/70 (26%)
I-set 273..360 CDD:254352 0/2 (0%)
Ig 290..359 CDD:143165
FN3 <466..524 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.