| Sequence 1: | NP_650080.3 | Gene: | dpr5 / 41381 | FlyBaseID: | FBgn0037908 | Length: | 336 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_009293693.1 | Gene: | igsf9bb / 569554 | ZFINID: | ZDB-GENE-091112-15 | Length: | 1439 | Species: | Danio rerio |
| Alignment Length: | 195 | Identity: | 45/195 - (23%) |
|---|---|---|---|
| Similarity: | 80/195 - (41%) | Gaps: | 32/195 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 90 PVFDNTTDREVIAALGTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTNDQRFLARHIDNS 154
Fly 155 DEW-----VLKIVSVQQRDAGVYECQVSTEPKISLAYKLVVVTSKAQILANRE-LFIQSGSDINL 213
Fly 214 TCIAPQAPGPYTH-MLWHKDTELVSDSARGGIRVESEQQMKTSNLVISRVQHTDSGNYTCSADNS 277
Fly 278 277 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr5 | NP_650080.3 | V-set | 95..191 | CDD:284989 | 19/100 (19%) |
| IG_like | 98..179 | CDD:214653 | 17/85 (20%) | ||
| IG_like | 206..278 | CDD:214653 | 21/73 (29%) | ||
| Ig | 211..278 | CDD:143165 | 20/68 (29%) | ||
| igsf9bb | XP_009293693.1 | IG_like | 30..113 | CDD:214653 | |
| Ig | 41..113 | CDD:143165 | |||
| IG_like | 144..223 | CDD:214653 | 18/98 (18%) | ||
| IGc2 | 151..208 | CDD:197706 | 15/76 (20%) | ||
| I-set | 227..319 | CDD:254352 | 23/85 (27%) | ||
| Ig | <263..319 | CDD:299845 | 14/49 (29%) | ||
| Ig_2 | 326..414 | CDD:290606 | |||
| IG_like | 329..403 | CDD:214653 | |||
| IG_like | 424..504 | CDD:214653 | |||
| Ig | 440..504 | CDD:299845 | |||
| FN3 | 509..604 | CDD:238020 | |||
| FN3 | 620..704 | CDD:238020 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||