Sequence 1: | NP_650080.3 | Gene: | dpr5 / 41381 | FlyBaseID: | FBgn0037908 | Length: | 336 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005169942.1 | Gene: | paplna / 562930 | ZFINID: | ZDB-GENE-070815-4 | Length: | 1187 | Species: | Danio rerio |
Alignment Length: | 204 | Identity: | 52/204 - (25%) |
---|---|---|---|
Similarity: | 83/204 - (40%) | Gaps: | 41/204 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 100 VIAALGTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTNDQRFLARHIDNSDEWVLKIVSV 164
Fly 165 QQRDAGVYECQVS-----TEPKISLAYKLVVVTSKAQILANRELFIQSGSDINLTCIAPQAPGPY 224
Fly 225 THMLWHKDTELVSDSARGGIRVESE-QQMKTS---NLVISRVQHTDSGNYTCSADN---SNSDSV 282
Fly 283 FVHIIKSEQ 291 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr5 | NP_650080.3 | V-set | 95..191 | CDD:284989 | 26/95 (27%) |
IG_like | 98..179 | CDD:214653 | 24/83 (29%) | ||
IG_like | 206..278 | CDD:214653 | 19/78 (24%) | ||
Ig | 211..278 | CDD:143165 | 17/73 (23%) | ||
paplna | XP_005169942.1 | TSP1 | 24..75 | CDD:214559 | |
ADAM_spacer1 | 181..293 | CDD:310520 | |||
TSP1 | 303..356 | CDD:214559 | |||
TSP1 | 388..442 | CDD:214559 | |||
TSP1 | 449..498 | CDD:214559 | |||
TSP1 | 504..557 | CDD:214559 | |||
KU | 720..771 | CDD:238057 | |||
Ig_3 | 839..906 | CDD:316449 | |||
IGc2 | 960..1022 | CDD:197706 | 22/73 (30%) | ||
I-set | 1039..1121 | CDD:333254 | 24/98 (24%) | ||
PLAC | 1142..1173 | CDD:312271 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |