DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and robo4

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_689255.3 Gene:robo4 / 560765 ZFINID:ZDB-GENE-020809-1 Length:1134 Species:Danio rerio


Alignment Length:292 Identity:68/292 - (23%)
Similarity:103/292 - (35%) Gaps:91/292 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PVDKQSRRSSQYFGHL--------------AAAEELSNLIPD-NYDAIDPVFDNTTDREVIAALG 105
            |.|:|..:.|:..|||              |...:.|.|:.: |   :..:..:.:|  |:..:|
Zfish    26 PPDEQVAQRSEGKGHLRHRLMHQRASHRDRAHRRKGSRLVSEIN---LPRIVHHPSD--VVVRVG 85

  Fly   106 TTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTNDQRFLARHIDNSDEWV------LKIVSV 164
            :.|.|.||.....:..:.|:|               |.|......:|...:.:      |...||
Zfish    86 SPATLSCRAEGNPEPTIQWLR---------------NGQPLDTDKMDAQSQPIVLPDGSLFFFSV 135

  Fly   165 ------QQRDAGVYECQVSTEPKISLAYKLV-VVTSK---AQILANRELFIQSGSDI-------- 211
                  |..:| ||.|         :|:..: ..||:   ..|.|.||.|....||:        
Zfish   136 VPGRKGQSHEA-VYAC---------IAHNSIGNATSRNASLHIAALREDFRVQPSDVEVAIGEMA 190

  Fly   212 NLTCIAPQAPGPYTHMLWHKDTELVSDSARGGIRVESEQQMKT---SNLVISRVQHTDSGNYTCS 273
            .:.| :|....|..::.|.||          ||.:.|..:..|   ..|:|:..|..|||.|:|.
Zfish   191 TINC-SPPVGHPEPNVTWRKD----------GILINSSNEHYTELKGKLIIAPAQKNDSGVYSCI 244

  Fly   274 ADNSNSDSVFVHIIKSEQHAAMQHELGSRLLL 305
            |.|.        |...|..||....|...:||
Zfish   245 ASNM--------IGVRESRAARLSVLAKPVLL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 21/108 (19%)
IG_like 98..179 CDD:214653 19/92 (21%)
IG_like 206..278 CDD:214653 22/82 (27%)
Ig 211..278 CDD:143165 20/77 (26%)
robo4XP_689255.3 Ig1_Robo 70..169 CDD:143317 23/125 (18%)
I-set 71..168 CDD:254352 23/123 (19%)
I-set 175..261 CDD:254352 27/104 (26%)
Ig2_Robo 177..261 CDD:143201 26/102 (25%)
I-set 265..350 CDD:254352 2/4 (50%)
Ig 282..350 CDD:299845
FN3 373..448 CDD:214495
FN3 472..560 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.