DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment dpr5 and lrit1a

DIOPT Version :9

Sequence 1:	NP_650080.3	Gene:	dpr5 / 41381	FlyBaseID:	FBgn0037908	Length:	336	Species:	Drosophila melanogaster
Sequence 2:	NP_001018174.2	Gene:	lrit1a / 553943	ZFINID:	ZDB-GENE-040924-5	Length:	643	Species:	Danio rerio

Alignment Length:	129	Identity:	29/129 - (22%)
Similarity:	50/129 - (38%)	Gaps:	37/129 - (28%)

- Green bases have known domain annotations that are detailed below.

  Fly   168 DAGVYECQVSTEPKISLAYKLVVVTSKAQILANRELFIQSGSDINLTCIAPQAPGPYTHMLWHK- 231
            ||.:..||   .|::..|    |...::.:          |:::.|.|.....|.|  .:.|.:
Zfish   243 DAELRRCQ---GPRVHTA----VARVRSAV----------GNNVLLRCGTVGVPIP--ELAWRRA 288

  Fly   232 ------DTELVSDSARGGIRVESEQQMKTSNLVISRVQHTDSGNYTCSADN--SNSDSVFVHII 287
                  .|.|:.:|..|         :..|.|.:..|.:.|:|.|.|.|.|  .::::|...||
Zfish   289 DGKPLNGTVLLENSKEG---------IVWSILSVPAVSYRDTGKYICKATNYAGSAEAVISLII 343

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
dpr5	NP_650080.3	V-set	95..191	CDD:284989	6/22 (27%)
		IG_like	98..179	CDD:214653	4/10 (40%)
		IG_like	206..278	CDD:214653	19/80 (24%)
		Ig	211..278	CDD:143165	18/75 (24%)
lrit1a	NP_001018174.2	leucine-rich repeat	61..84	CDD:275378
		LRR_8	63..119	CDD:290566
		LRR_RI	<77..175	CDD:238064
		leucine-rich repeat	85..108	CDD:275378
		LRR_8	108..167	CDD:290566
		leucine-rich repeat	109..132	CDD:275378
		leucine-rich repeat	133..156	CDD:275378
		leucine-rich repeat	157..170	CDD:275378
		LRRCT	199..243	CDD:214507	29/129 (22%)
		I-set	252..343	CDD:254352	23/115 (20%)
		Ig	259..333	CDD:299845	19/94 (20%)
		fn3	448..515	CDD:278470
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3510
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900