DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and Ntm

DIOPT Version :10

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001418383.1 Gene:Ntm / 50864 RGDID:620958 Length:367 Species:Rattus norvegicus


Alignment Length:345 Identity:75/345 - (21%)
Similarity:121/345 - (35%) Gaps:127/345 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 DAIDP-VFDNTTDREVIAALGTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTNDQRFLAR 149
            ||..| ..||.|.|:     |.:|.|.|.:.:...| |:|:.:..  ||..|...:..|.|.:. 
  Rat    35 DATFPKAMDNVTVRQ-----GESATLRCTIDNRVTR-VAWLNRST--ILYAGNDKWCLDPRVVL- 90

  Fly   150 HIDNSD-EWVLKIVSVQQRDAGVYECQVSTE--PKISLAYKLVVVTSKAQILANRELFIQSGSDI 211
             :.|:. ::.::|.:|...|.|.|.|.|.|:  ||.|..:.:|.|:.|. :..:.::.|..|::|
  Rat    91 -LSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKI-VEISSDISINEGNNI 153

  Fly   212 NLTCIA--------------PQAPG---------------------------------------- 222
            :|||||              |:|.|                                        
  Rat   154 SLTCIATGRPEPTVTWRHISPKAVGFVSEDEYLEIQGITREQSGEYECSASNDVAAPVVRRVKVT 218

  Fly   223 ------------------------------PYTHMLWHKDTELVSDSARGGIRVESEQQMKTSNL 257
                                          |.....|.||.:.:.:..: |::||:...:  |.|
  Rat   219 VNYPPYISEAKGTGVPVGQKGTLQCEASAVPSAEFQWFKDDKRLVEGKK-GVKVENRPFL--SRL 280

  Fly   258 VISRVQHTDSGNYTCSADNS---NSDSVFVHIIKSEQHAAMQHELGSRLLLP---P--------- 307
            ....|...|.|||||.|.|.   .:.|:.:..:.....:.:..|:.:..|.|   |         
  Rat   281 TFFNVSEHDYGNYTCVASNKLGHTNASIMLFELNEPTSSTLLQEVKTTALTPWKGPGAVSEVNNG 345

  Fly   308 ----------LPLLLLAVLL 317
                      ||||:|.:||
  Rat   346 TSRRAGCIWLLPLLVLHLLL 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 FR1 96..113 CDD:409355 5/16 (31%)
IG_like 98..179 CDD:214653 21/81 (26%)
Ig strand A' 100..102 CDD:409355 0/1 (0%)
Ig strand B 106..114 CDD:409355 3/7 (43%)
CDR1 114..120 CDD:409355 0/5 (0%)
FR2 121..132 CDD:409355 2/10 (20%)
Ig strand C 121..127 CDD:409355 2/5 (40%)
Ig strand C' 130..133 CDD:409355 0/2 (0%)
CDR2 133..146 CDD:409355 3/12 (25%)
Ig strand D 146..151 CDD:409355 0/4 (0%)
FR3 147..176 CDD:409355 7/29 (24%)
Ig strand E 155..162 CDD:409355 0/7 (0%)
Ig strand F 170..177 CDD:409355 3/6 (50%)
IG_like 206..278 CDD:214653 28/158 (18%)
Ig strand B 211..215 CDD:409353 2/3 (67%)
Ig strand C 226..230 CDD:409353 0/3 (0%)
Ig strand E 255..259 CDD:409353 2/3 (67%)
Ig strand F 269..274 CDD:409353 4/4 (100%)
NtmNP_001418383.1 Ig 44..132 CDD:472250 27/97 (28%)
Ig strand B 53..57 CDD:409382 2/3 (67%)
Ig strand C 65..69 CDD:409382 2/4 (50%)
Ig strand E 98..102 CDD:409382 0/3 (0%)
Ig strand F 112..117 CDD:409382 2/4 (50%)
Ig strand G 125..128 CDD:409382 1/2 (50%)
Ig_3 136..205 CDD:464046 12/69 (17%)
Ig 223..307 CDD:472250 18/86 (21%)
Ig strand B 239..243 CDD:409408 0/3 (0%)
Ig strand C 252..256 CDD:409408 0/3 (0%)
Ig strand E 278..282 CDD:409408 2/3 (67%)
Ig strand F 292..297 CDD:409408 4/4 (100%)

Return to query results.
Submit another query.