DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and dpr12

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster


Alignment Length:317 Identity:116/317 - (36%)
Similarity:165/317 - (52%) Gaps:44/317 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LVEYFMALL----VIMGLTAPVDKQSRRSSQYF------GHLAAAEELSNLIPDNYDAID-PVFD 93
            |:|..:.||    :::..|...|::|..:...:      |.:....:|.|    |.|:.| |:|:
  Fly    18 LMELRILLLCLPTLLLATTLEPDQKSILTDNDWKKLWMRGGINGDSKLDN----NLDSSDSPMFE 78

  Fly    94 NTTDREVIA-----ALGTTARLHCRVRHLGDRA------VSWIRQRDLHILTIGIMTYTNDQRFL 147
               |.|::|     .||.||.|.|:|..: ||.      :||||:||.|||:.|...||||:||.
  Fly    79 ---DSELMAHNTTVQLGGTAFLVCKVSGV-DRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFA 139

  Fly   148 ARHIDNSDEWVLKIVSVQQRDAGVYECQVSTEPK-ISLAYKLVVVTSKAQILANRELFIQSGSDI 211
            ..|...|:.|.|:|..||:||.|:|||||||... ||....|.||..:|.||.:.||.:..||.|
  Fly   140 ILHTPGSNMWTLQIKFVQRRDHGMYECQVSTPTGIISHFVNLQVVVPEAFILGSGELHVDMGSTI 204

  Fly   212 NLTCIAPQAPGPYTHMLWHKDTELVS--DSARGGIRVESEQQMKT-SNLVISRVQHTDSGNYTCS 273
            ||.||..::|.|..::.|.|:..|::  ||.| .|.:|:....:| |.|:|...|.|||||||||
  Fly   205 NLVCIIEKSPTPPQYVYWQKNDRLINYVDSRR-DITIETTPGPRTQSRLIIREPQVTDSGNYTCS 268

  Fly   274 ADNSNSDSVFVHIIKSEQHAAMQHELGS---------RLLLPPLPLLLLAVLLVVLL 321
            |.|:...|::|.:.|.:..||:.....|         |.:|.|..||...|:..:.|
  Fly   269 ASNTEPASIYVFVSKGDNMAAISRRKTSSADRLTHIFRSMLAPCLLLNTVVVRHIFL 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 48/107 (45%)
IG_like 98..179 CDD:214653 43/91 (47%)
IG_like 206..278 CDD:214653 33/74 (45%)
Ig 211..278 CDD:143165 31/69 (45%)
dpr12NP_652462.3 IG 86..183 CDD:214652 45/97 (46%)
Ig_3 193..271 CDD:404760 34/78 (44%)
Ig strand B 204..208 CDD:409353 3/3 (100%)
Ig strand C 219..223 CDD:409353 0/3 (0%)
Ig strand E 250..254 CDD:409353 2/3 (67%)
Ig strand F 264..269 CDD:409353 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.