DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and dpr6

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster


Alignment Length:347 Identity:124/347 - (35%)
Similarity:183/347 - (52%) Gaps:64/347 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IAH--EMLVEYFMALLVIM-------GLTAPVDKQSRRSSQYFGHLAAAEELSN---------LI 81
            |||  .:.|.:.:.|:||:       |:..|::          |:.:..:.|:.         |:
  Fly     3 IAHPLPLCVAWLLLLVVIVMSDMTNGGVQGPIE----------GYNSLDDLLTTTPTPGQAALLL 57

  Fly    82 PDNYDA-------IDPVFDNTTDREVIAALGTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMT 139
            |....|       ::|.||.:|.|.|.|.:|.:|.|.||||:|.::.|||||.||:||||:|..|
  Fly    58 PTAPTAAYTHPKWMEPYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYT 122

  Fly   140 YTNDQRFLARHIDNSDEWVLKIVSVQQRDAGVYECQVSTEPKISLAYKLVVVTSKAQILANRELF 204
            ||:||||.|.|..::::|.|:|...|:||||:||||:||:|..|...:|.||...|.||...:|.
  Fly   123 YTSDQRFQATHHQDTEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPTATILGGPDLH 187

  Fly   205 IQSGSDINLTCIAPQAPGPYTHMLWHKDTELVS-DSARGGIRVESEQ-QMKTSNLVISRVQHTDS 267
            :..||.|||||....:|.|..::.|:...|::: ||:|||:.|.:|: .:.||.|:|......||
  Fly   188 VDKGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQNADLADS 252

  Fly   268 GNYTCSADNSNSDSVFVH------IIKSEQHAAMQHELGSR------LLLPPLPLLLLAVLL--- 317
            |.|:|:..|::..||.||      ||..|...|||  .||.      |.:    :|||.::|   
  Fly   253 GKYSCAPSNADVASVRVHVLNVRAIISGEHPEAMQ--TGSSGCQYNWLTI----VLLLGLVLCYS 311

  Fly   318 ------VVLLGPTSSLQIRTPL 333
                  .|....||||.:.:.|
  Fly   312 SQQCSSAVPASLTSSLPLPSQL 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 50/95 (53%)
IG_like 98..179 CDD:214653 45/80 (56%)
IG_like 206..278 CDD:214653 28/73 (38%)
Ig 211..278 CDD:143165 26/68 (38%)
dpr6NP_001287018.1 V-set 79..174 CDD:284989 50/94 (53%)
IG_like 80..175 CDD:214653 50/94 (53%)
IG_like 184..271 CDD:214653 32/86 (37%)
IGc2 191..262 CDD:197706 27/70 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444742
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.