| Sequence 1: | NP_650080.3 | Gene: | dpr5 / 41381 | FlyBaseID: | FBgn0037908 | Length: | 336 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001306032.1 | Gene: | OPCML / 4978 | HGNCID: | 8143 | Length: | 354 | Species: | Homo sapiens |
| Alignment Length: | 199 | Identity: | 55/199 - (27%) |
|---|---|---|---|
| Similarity: | 88/199 - (44%) | Gaps: | 35/199 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 86 DAIDP-VFDNTTDREVIAALGTTARLHCRVRHLGDRA--VSWIRQRDLHILTIGIMTYTNDQRFL 147
Fly 148 ARHIDNSDEWVLKIVSVQQRDAGVYECQVSTE--PKISLAYKLVVVTSKAQILANRELFIQSGSD 210
Fly 211 INLTCIAPQAPGP---YTHMLWHKDTELVSDSARGGIRVESEQQMKTSNLVISRVQHTDSGNYTC 272
Fly 273 SADN 276 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr5 | NP_650080.3 | FR1 | 96..113 | CDD:409355 | 5/16 (31%) |
| IG_like | 98..179 | CDD:214653 | 21/82 (26%) | ||
| Ig strand A' | 100..102 | CDD:409355 | 0/1 (0%) | ||
| Ig strand B | 106..114 | CDD:409355 | 3/7 (43%) | ||
| CDR1 | 114..120 | CDD:409355 | 0/5 (0%) | ||
| FR2 | 121..132 | CDD:409355 | 2/12 (17%) | ||
| Ig strand C | 121..127 | CDD:409355 | 2/7 (29%) | ||
| Ig strand C' | 130..133 | CDD:409355 | 0/2 (0%) | ||
| CDR2 | 133..146 | CDD:409355 | 3/12 (25%) | ||
| Ig strand D | 146..151 | CDD:409355 | 0/4 (0%) | ||
| FR3 | 147..176 | CDD:409355 | 6/28 (21%) | ||
| Ig strand E | 155..162 | CDD:409355 | 0/6 (0%) | ||
| Ig strand F | 170..177 | CDD:409355 | 3/6 (50%) | ||
| IG_like | 206..278 | CDD:214653 | 22/74 (30%) | ||
| Ig strand B | 211..215 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 226..230 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 255..259 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 269..274 | CDD:409353 | 2/4 (50%) | ||
| OPCML | NP_001306032.1 | Ig | 44..132 | CDD:472250 | 27/98 (28%) |
| Ig strand B | 53..57 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C | 65..69 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 98..102 | CDD:409353 | 0/3 (0%) | ||
| Ig strand F | 112..117 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 125..128 | CDD:409353 | 1/2 (50%) | ||
| Ig_3 | 135..206 | CDD:464046 | 21/86 (24%) | ||
| Ig | 224..312 | CDD:472250 | |||
| Ig strand B | 240..244 | CDD:409353 | |||
| Ig strand C | 253..257 | CDD:409353 | |||
| Ig strand E | 279..283 | CDD:409353 | |||
| Ig strand F | 293..298 | CDD:409353 | |||
| Ig strand G | 306..309 | CDD:409353 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||