DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and opcml

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001005580.1 Gene:opcml / 449538 ZFINID:ZDB-GENE-040927-3 Length:342 Species:Danio rerio


Alignment Length:370 Identity:78/370 - (21%)
Similarity:134/370 - (36%) Gaps:131/370 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 MGLTAPVDKQSRRSSQYFGHLAAAEELSNLIP--------DNYDAIDPVFDNTTDREVIAALGTT 107
            ||:|...:.|.:..      :..|..|..|:|        |:|     :.||.|.|:     |.:
Zfish     1 MGITGYFELQWKCL------VVVALRLLFLVPAGVPARSGDSY-----LKDNITVRQ-----GDS 49

  Fly   108 ARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTNDQRFLARHIDNS--DEWVLKIVSVQQRDAG 170
            |.|.|.:.:...| |:|:.:..  ||..|...::.|.|.:   :.|:  :|:.:||::|...|.|
Zfish    50 AVLKCSMDNKVSR-VAWLNRTT--ILFTGNEKWSLDPRVV---LLNTAVNEYSIKILNVNLYDEG 108

  Fly   171 VYECQVSTEPKISLAYKLVVVTSKAQIL-ANRELFIQSGSDINLTCIAPQAPGPYTHMLW----H 230
            .|.|.:.|..|.......::|...|:|: .:.::.:..||:::|.|:|...|.|  .:||    .
Zfish   109 PYVCSILTNKKPESTKVHLIVQVPARIVNVSTDVSVNEGSNVSLMCLAIGRPEP--SILWKFRSS 171

  Fly   231 KDTELVSDS--------------------------------------------AR---------- 241
            |...:|::.                                            ||          
Zfish   172 KGNRIVTEGEYVEMTGITKDMSGSYDCITSNDISPPDVRTVQVTVNYPPVISRARSTGTAVGQKG 236

  Fly   242 ---------------------------GGIRVESEQQMKTSNLVISRVQHTDSGNYTCSADNS-- 277
                                       .|:::|::.  |.|.|....|...|.|||||.|.|:  
Zfish   237 VLWCEASAVPLADFQWFKGERRILNGFNGVKIENKG--KQSMLTFFNVSEEDYGNYTCVAINTLG 299

  Fly   278 -NSDSVFVHIIKSEQHAAMQHELGSRLLLPPLPLLLLAVLLVVLL 321
             .:.|:.::      .....|::.:..|.|...||||.:||.:.|
Zfish   300 ITNASIILY------GPGAIHDVNNAALSPTCSLLLLTLLLTLSL 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 25/97 (26%)
IG_like 98..179 CDD:214653 22/82 (27%)
IG_like 206..278 CDD:214653 27/159 (17%)
Ig 211..278 CDD:143165 25/154 (16%)
opcmlNP_001005580.1 Ig 41..129 CDD:299845 26/98 (27%)
IG_like 41..129 CDD:214653 26/98 (27%)
IG_like 139..216 CDD:214653 11/78 (14%)
IGc2 146..202 CDD:197706 11/57 (19%)
I-set 219..307 CDD:254352 17/89 (19%)
ig 223..307 CDD:278476 17/85 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.