DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and opcml

DIOPT Version :10

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001005580.1 Gene:opcml / 449538 ZFINID:ZDB-GENE-040927-3 Length:342 Species:Danio rerio


Alignment Length:370 Identity:78/370 - (21%)
Similarity:134/370 - (36%) Gaps:131/370 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 MGLTAPVDKQSRRSSQYFGHLAAAEELSNLIP--------DNYDAIDPVFDNTTDREVIAALGTT 107
            ||:|...:.|.:..      :..|..|..|:|        |:|     :.||.|.|:     |.:
Zfish     1 MGITGYFELQWKCL------VVVALRLLFLVPAGVPARSGDSY-----LKDNITVRQ-----GDS 49

  Fly   108 ARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTNDQRFLARHIDNS--DEWVLKIVSVQQRDAG 170
            |.|.|.:.:...| |:|:.:..  ||..|...::.|.|.:   :.|:  :|:.:||::|...|.|
Zfish    50 AVLKCSMDNKVSR-VAWLNRTT--ILFTGNEKWSLDPRVV---LLNTAVNEYSIKILNVNLYDEG 108

  Fly   171 VYECQVSTEPKISLAYKLVVVTSKAQIL-ANRELFIQSGSDINLTCIAPQAPGPYTHMLW----H 230
            .|.|.:.|..|.......::|...|:|: .:.::.:..||:::|.|:|...|.|  .:||    .
Zfish   109 PYVCSILTNKKPESTKVHLIVQVPARIVNVSTDVSVNEGSNVSLMCLAIGRPEP--SILWKFRSS 171

  Fly   231 KDTELVSDS--------------------------------------------AR---------- 241
            |...:|::.                                            ||          
Zfish   172 KGNRIVTEGEYVEMTGITKDMSGSYDCITSNDISPPDVRTVQVTVNYPPVISRARSTGTAVGQKG 236

  Fly   242 ---------------------------GGIRVESEQQMKTSNLVISRVQHTDSGNYTCSADNS-- 277
                                       .|:::|::.  |.|.|....|...|.|||||.|.|:  
Zfish   237 VLWCEASAVPLADFQWFKGERRILNGFNGVKIENKG--KQSMLTFFNVSEEDYGNYTCVAINTLG 299

  Fly   278 -NSDSVFVHIIKSEQHAAMQHELGSRLLLPPLPLLLLAVLLVVLL 321
             .:.|:.::      .....|::.:..|.|...||||.:||.:.|
Zfish   300 ITNASIILY------GPGAIHDVNNAALSPTCSLLLLTLLLTLSL 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 FR1 96..113 CDD:409355 5/16 (31%)
IG_like 98..179 CDD:214653 22/82 (27%)
Ig strand A' 100..102 CDD:409355 0/1 (0%)
Ig strand B 106..114 CDD:409355 3/7 (43%)
CDR1 114..120 CDD:409355 0/5 (0%)
FR2 121..132 CDD:409355 2/10 (20%)
Ig strand C 121..127 CDD:409355 2/5 (40%)
Ig strand C' 130..133 CDD:409355 0/2 (0%)
CDR2 133..146 CDD:409355 3/12 (25%)
Ig strand D 146..151 CDD:409355 0/4 (0%)
FR3 147..176 CDD:409355 9/30 (30%)
Ig strand E 155..162 CDD:409355 2/6 (33%)
Ig strand F 170..177 CDD:409355 3/6 (50%)
IG_like 206..278 CDD:214653 27/159 (17%)
Ig strand B 211..215 CDD:409353 1/3 (33%)
Ig strand C 226..230 CDD:409353 2/7 (29%)
Ig strand E 255..259 CDD:409353 2/3 (67%)
Ig strand F 269..274 CDD:409353 4/4 (100%)
opcmlNP_001005580.1 Ig 41..129 CDD:472250 26/98 (27%)
Ig strand B 50..54 CDD:409353 2/3 (67%)
Ig strand C 62..66 CDD:409353 2/4 (50%)
Ig strand E 95..99 CDD:409353 0/3 (0%)
Ig strand F 109..114 CDD:409353 2/4 (50%)
Ig strand G 122..125 CDD:409353 0/2 (0%)
Ig 128..214 CDD:472250 14/87 (16%)
Ig strand B 150..154 CDD:409353 1/3 (33%)
Ig strand C 163..167 CDD:409353 1/3 (33%)
Ig strand E 181..185 CDD:409353 0/3 (0%)
Ig strand F 195..200 CDD:409353 0/4 (0%)
Ig 220..308 CDD:472250 17/89 (19%)
Ig strand B 236..240 CDD:409353 0/3 (0%)
Ig strand C 249..253 CDD:409353 0/3 (0%)
Ig strand E 275..279 CDD:409353 2/3 (67%)
Ig strand F 289..294 CDD:409353 4/4 (100%)
Ig strand G 302..305 CDD:409353 0/2 (0%)

Return to query results.
Submit another query.