DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and negr1

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_009300786.1 Gene:negr1 / 445374 ZFINID:ZDB-GENE-040822-27 Length:360 Species:Danio rerio


Alignment Length:228 Identity:64/228 - (28%)
Similarity:107/228 - (46%) Gaps:30/228 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 DNTTDRE-VIAALGTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTNDQRF-LARHIDNSD 155
            |.||..| |::..|.||.|.|.:.. |....:|:.:..  |:..|...::.|.|. :..::.:..
Zfish    39 DYTTSSESVVSRQGDTALLRCYLLD-GISKGAWLNRSS--IIYAGNDKWSGDPRVSIVSNVGDKH 100

  Fly   156 EWVLKIVSVQQRDAGVYECQVSTE----PKISLAYKLVVVTSKAQILANRELFIQSGSDINLTCI 216
            |:.|:|..|...|.|||.|.:.:|    ||  |...:|.|..|...::: ::.:..||:::|.|.
Zfish   101 EYSLQIQKVDVTDEGVYTCSIQSERNLHPK--LIQLIVKVPPKIYDISS-DITVNEGSNVSLICA 162

  Fly   217 APQAPGPYTHMLWHKDTELVSDSARGGIRVESEQQMKTSNLVISRVQHTDSGNYTCSADN--SNS 279
            |...|.|  .:.|..    :|.|||   :.||.:.:..:.  |||.|   :|:|.|.|:|  ::.
Zfish   163 ASGKPEP--KISWRH----ISPSAR---KYESGEYLNITG--ISRDQ---AGDYECGAENDIASP 213

  Fly   280 DSVFVHIIKSEQHAAMQHELGSRLLLPPLPLLL 312
            |:..|.:..:...|.  ||:.|..:.|....||
Zfish   214 DTKTVRVTVNFPPAI--HEMKSHGVRPGQVALL 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 29/101 (29%)
IG_like 98..179 CDD:214653 22/82 (27%)
IG_like 206..278 CDD:214653 23/73 (32%)
Ig 211..278 CDD:143165 21/68 (31%)
negr1XP_009300786.1 Ig 42..121 CDD:299845 23/81 (28%)
IG_like 44..136 CDD:214653 26/96 (27%)
I-set 140..222 CDD:254352 26/96 (27%)
IGc2 153..208 CDD:197706 22/68 (32%)
IG_like 236..312 CDD:214653 3/9 (33%)
IGc2 238..304 CDD:197706 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.