DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and klg

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster


Alignment Length:190 Identity:55/190 - (28%)
Similarity:87/190 - (45%) Gaps:30/190 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 AALGTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTNDQRFLARHIDNSDEWVLKIVSVQQ 166
            |.:|.|..|.|:|.:||:..:.|  :|..::||...:..|.|:|  .|.||.   :.|:|..::.
  Fly   112 AVVGDTLVLPCQVENLGNFVLLW--RRGTNVLTASNIMVTRDER--VRLIDG---YNLEISDLEP 169

  Fly   167 RDAGVYECQVSTEPKISL----AYKLVVVTSKAQILANRELFIQSGSDINLTCIAPQAPGPYTHM 227
            :|||.|.||:|  .||:.    ..:::|..|...|..:.:|..:.|..|.|.|.....|.|  .:
  Fly   170 QDAGDYVCQIS--DKINRDQVHTVEILV
PPSVRAIPTSGQLQARKGGPITLECKGSGNPVP--SI 230

  Fly   228 LWHKDTELVSDSAR---GGIRVESEQQMKTSNLVISRVQHTDSGNYTCSADNSNSDSVFV 284
            .|.|.:.....:||   |.|            |.:.:::...:|.|.|:|||...|.|.|
  Fly   231 YWTKKSGANKSTARIGDGPI------------LTLEKLERQQAGVYQCTADNGVGDPVTV 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 29/92 (32%)
IG_like 98..179 CDD:214653 27/76 (36%)
IG_like 206..278 CDD:214653 19/74 (26%)
Ig 211..278 CDD:143165 18/69 (26%)
klgNP_524454.2 DUF1370 63..>124 CDD:284518 5/11 (45%)
IG_like 109..195 CDD:214653 29/91 (32%)
Ig 118..191 CDD:143165 26/81 (32%)
IG_like 205..274 CDD:214653 20/82 (24%)
IGc2 213..273 CDD:197706 19/73 (26%)
IGc2 301..367 CDD:197706
FN3 392..486 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.