DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and Dscam3

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster


Alignment Length:241 Identity:59/241 - (24%)
Similarity:90/241 - (37%) Gaps:62/241 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 GTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTNDQRFLARHIDNSDEWVLKIVSVQQRDA 169
            |.||..:|........|:.|:...........:.|..::.|||::.       .|.:.:|.:||.
  Fly   355 GGTANFNCTTTGSAIDAIDWLHNGKPLQANNALTTGRDNIRFLSKS-------SLLVQNVGRRDR 412

  Fly   170 GVYECQVSTEPKISLAYKLVVVTSKAQILANREL----------FIQS----GSDINLTCIAPQA 220
            |||:|.|..:            .:.||.:|..:|          ||:.    |..|:|.|.|..:
  Fly   413 GVYQCLVENQ------------RASAQAMAELK
LGDTVPELIYTFIEQNVRPGPLISLKCSASGS 465

  Fly   221 PGPYTHMLWHKDTELVSD-SARGGIRVESEQQMK---TSNLVISRVQHTDSGNYTCSADNSNSDS 281
            |.|  ...|..|::.:.| |......:.....|.   .|:|.||.|:..|.|.|.|.|.||    
  Fly   466 PPP--QFAWLLDSQPIMDVSLHHRFAIGQFVDMSGDVISHLNISHVRPDDGGLYKCVASNS---- 524

  Fly   282 VFVHIIKSEQHAAMQHELGSRLLLPPLPLLLLAVLLVVLLGPTSSL 327
                 :.|.||:|..:..|     ||         .|..:||..::
  Fly   525 -----MGSVQHSARLNVYG-----PP---------YVRAIGPIKAV 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 19/85 (22%)
IG_like 98..179 CDD:214653 19/73 (26%)
IG_like 206..278 CDD:214653 23/79 (29%)
Ig 211..278 CDD:143165 22/70 (31%)
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352
Ig 264..334 CDD:143165
I-set 345..433 CDD:254352 22/96 (23%)
Ig 358..431 CDD:143165 19/91 (21%)
Ig 456..533 CDD:143165 26/87 (30%)
IGc2 553..619 CDD:197706
I-set 634..724 CDD:254352
ig 645..712 CDD:278476
IG_like 734..815 CDD:214653
Ig 745..815 CDD:299845
I-set 820..913 CDD:254352
Ig 838..920 CDD:299845
FN3 917..1033 CDD:238020
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.