DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and dpr17

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster


Alignment Length:304 Identity:85/304 - (27%)
Similarity:152/304 - (50%) Gaps:38/304 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AVRATFTSTTATESSPLIGKVISNSRAPQIAHEMLVEYFMALLVIMGLTAPVDKQSRRSSQYFGH 70
            |.||   :..|.|::.|..:..:.:.|.:.:.|.:.            .:|.:::.:..::...:
  Fly   340 AYRA---AADAAEAAKLAAEAAAQAAAAKTSSEAVT------------MSPEEQRRQMFNEQHSY 389

  Fly    71 LAA----AEELSNLIPDNYDAIDPVFDNTTDREVIAALGTTARLHCRVRHLGDRAVSWIRQRDLH 131
            |||    .:...:.:..|...  ||.:      :.|.:|..|.:.|::..|.|:.|||:|.||.|
  Fly   390 LAAHRDGGDGAGSAVRRNLTM--PVLN------ITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNH 446

  Fly   132 ILTIGIMTYTNDQRFLARHIDNSD-EWVLKIVSVQQRDAGVYECQVSTEPKISLAYKLVVVTSKA 195
            |:::...|:..|:||.:.:.::.| .|.|:|..|:..|||.||||::||||:|....|.:|..|.
  Fly   447 IISVDETTFIADERFQSIYQEDHDYTWSLQIKYVEPSDAGWYECQMATEPKLSAKVHLQIVKPKT 511

  Fly   196 QILANRELFIQSGSDINLTCIAPQAPGPYTHMLWHKDTELVSDS-ARGGIRVE---------SEQ 250
            :::.::..|:::||.:.|.||......|..:::|.:..:.:||| .|.|...:         .:.
  Fly   512 ELIGDQSRFVKAGSKVALHCIVRGTLDPPKYIIWFRGQKKISDSDERTGWYTQLDRNIFGTVGDN 576

  Fly   251 QMKTSNLVISRVQHTDSGNYTCSADNSNSDSVFVHIIKSEQHAA 294
            |....:|:|..|:..|||||||...||.|.||.:|::..|..|:
  Fly   577 QNTIGSLIIPLVRKEDSGNYTCQPSNSVSVSVDLHVLSGEYSAS 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 36/96 (38%)
IG_like 98..179 CDD:214653 30/81 (37%)
IG_like 206..278 CDD:214653 24/81 (30%)
Ig 211..278 CDD:143165 22/76 (29%)
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 28/82 (34%)
Ig 415..507 CDD:299845 36/91 (40%)
IG_like 521..612 CDD:214653 28/90 (31%)
IGc2 524..605 CDD:197706 25/80 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444708
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.