DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and Ama

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster


Alignment Length:199 Identity:47/199 - (23%)
Similarity:84/199 - (42%) Gaps:23/199 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 PVFDNTTDREVIAALGTTARLHCRVRHLGDRAVSWIR---QRDLHILTIGIMTYTN--DQRFLAR 149
            ||....: ::|:|::|.:...:|.|..:|..:|||.:   :.|.:.:.:.:....:  |||:...
  Fly    33 PVISQIS-KDVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLPDQRYNVT 96

  Fly   150 HID----NSDEWVLKIVSVQQRDAGVYECQVSTEPKISLAYKLVVVTSKAQILAN---RELFIQS 207
            ..:    .|..:..:|.:::..|.|.|||||.......:..||.:......::|.   :...:..
  Fly    97 VTEGPKTGSAIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSLQIKTPPVIAENTPKSTLVTE 161

  Fly   208 GSDINLTCIAPQAPGPYTHMLWHKDTELVSDSARGGIRVESEQQMKTSNLVISRVQHTDSGNYTC 272
            |.::.|||.|...|.|  .:.|.::...|..:  ||      ..:....|.|..|...|.|.|.|
  Fly   162 GQNLELTCHANGFPKP--TISWAREHNAVMPA--GG------HLLAEPTLRIRSVHRMDRGGYYC 216

  Fly   273 SADN 276
            .|.|
  Fly   217 IAQN 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 24/104 (23%)
IG_like 98..179 CDD:214653 22/89 (25%)
IG_like 206..278 CDD:214653 20/71 (28%)
Ig 211..278 CDD:143165 19/66 (29%)
AmaNP_731114.2 I-set 33..143 CDD:254352 26/110 (24%)
Ig 37..127 CDD:299845 20/90 (22%)
IG_like 154..234 CDD:214653 20/77 (26%)
IGc2 161..223 CDD:197706 20/70 (29%)
I-set 254..330 CDD:254352
IGc2 254..322 CDD:197706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.