DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and dpr11

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster


Alignment Length:275 Identity:105/275 - (38%)
Similarity:152/275 - (55%) Gaps:23/275 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 SSQYFGHLAAAEELSNLIPD------NYDAIDPVFDNTTDREVIAALGTTARLHCRVRHLGDRAV 122
            |:..|..||   ::|:|:|:      ....::|..|......|...:||.|.|.|||:.||:::|
  Fly    88 SATAFSSLA---QVSSLLPEASALSATSGLVEPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSV 149

  Fly   123 SWIRQRDLHILTIGIMTYTNDQRFLARHIDNSDE-WVLKIVSVQQRDAGVYECQVSTEPKISLAY 186
            ||||.||.||||:....:..||||||  |...|: |.|:|..||.||||.||||||||||:|...
  Fly   150 SWIRLRDGHILTVDRAVFIADQRFLA--IKQPDKYWTLQIKYVQARDAGSYECQVSTEPKVSARV 212

  Fly   187 KLVVVTSKAQILANRELFIQSGSDINLTCIAPQAPGPYTHMLW-HKDTELVSDSARGGIRVE--- 247
            :|.||..:.:||...:.::::||::.|.||...|..|.|.::| |...:|.:||.|...:::   
  Fly   213 QLQVVVPRTEILGEPDRYVKAGSNVVLRCIVRGALEPPTFIMWYHGAEQLAADSRRHRTQLDPNL 277

  Fly   248 ----SEQQMKTSNLVISRVQHTDSGNYTCSADNSNSDSVFVHIIKSEQHAAMQHELGSRLLLPPL 308
                .|.|....:|:|...:..|:||||||..||.|.:|.::||..|..|:.  ...|.......
  Fly   278 PEASGEGQSTIGSLIIESAKKRDTGNYTCSPSNSPSATVTLNIINGESSASA--VTSSAATTRAY 340

  Fly   309 PLLLLAVLL-VVLLG 322
            .|.:||:|| |:|:|
  Fly   341 ALSILALLLSVILIG 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 50/96 (52%)
IG_like 98..179 CDD:214653 44/81 (54%)
IG_like 206..278 CDD:214653 26/79 (33%)
Ig 211..278 CDD:143165 24/74 (32%)
dpr11NP_001262320.1 I-set 125..216 CDD:254352 50/92 (54%)
Ig 127..217 CDD:299845 50/91 (55%)
IG_like 227..320 CDD:214653 29/92 (32%)
IGc2 234..311 CDD:197706 25/76 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444712
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.