DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and LSAMP

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001305844.1 Gene:LSAMP / 4045 HGNCID:6705 Length:361 Species:Homo sapiens


Alignment Length:340 Identity:72/340 - (21%)
Similarity:119/340 - (35%) Gaps:131/340 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 DNTTDREVIAALGTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTNDQRFLARHID----N 153
            ||.|.|:     |.||.|.|.|.....: |:|:.:.       ||:...:|:..|...::    :
Human    39 DNITVRQ-----GDTAILRCVVEDKNSK-VAWLNRS-------GIIFAGHDKWSLDPRVELEKRH 90

  Fly   154 SDEWVLKIVSVQQRDAGVYECQVST--EPKISLAYKLVVVTSKAQILANRELFIQSGSDINLTCI 216
            |.|:.|:|..|...|.|.|.|.|.|  |||.|..|.:|.|..|...::: ::.:..||::.|.|:
Human    91 SLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISS-DVTVNEGSNVTLVCM 154

  Fly   217 APQAPGP-------------------YTHML---------------------------------- 228
            |...|.|                   |..:|                                  
Human   155 ANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPP 219

  Fly   229 -------------------------------WHKDTELVSDSARGGIRVESEQQMKTSNLVISRV 262
                                           |::|...::.:  .|:.::|.:..  |:|.::.|
Human   220 TITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSA--NGLEIKSTEGQ--SSLTVTNV 280

  Fly   263 QHTDSGNYTCSADN----SNSDSV-FVHIIKSEQHAAMQHELGSRL----------------LLP 306
            .....|||||.|.|    :|:..| |..::.:..|..  .|:|:.:                :..
Human   281 TEEHYGNYTCVAANKLGVTNASLVLFKRVLPTIPHPI--QEIGTTVHFKQKGPGSVRGINGSISL 343

  Fly   307 PLPLLLLAVLLVVLL 321
            .:||.|||..|:.||
Human   344 AVPLWLLAASLLCLL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 31/101 (31%)
IG_like 98..179 CDD:214653 24/86 (28%)
IG_like 206..278 CDD:214653 23/159 (14%)
Ig 211..278 CDD:143165 21/154 (14%)
LSAMPNP_001305844.1 Ig 38..128 CDD:386229 32/101 (32%)
Ig 132..215 CDD:386229 10/83 (12%)
Ig_3 219..294 CDD:372822 13/78 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.