DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and CG7166

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster


Alignment Length:225 Identity:64/225 - (28%)
Similarity:99/225 - (44%) Gaps:49/225 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 SNLIPDNYDAIDPVFDNTTDREVIA-------ALGTTARLHCRVRHLGDRAVSWIRQRDLHILTI 135
            |.::|:|    ||   .||..:.::       .:|.|..|.|:|::||...:.|  ::...:||.
  Fly    26 SFILPEN----DP---PTTAPKFLSRGHLYKVIVGETIELPCKVQNLGSFVLLW--RKGSSVLTA 81

  Fly   136 GIMTYTNDQRFLARHIDNSDEWVLKIVSVQQRDAGVYECQVSTE---PKISLAYKLVVVTSKAQI 197
            |.:..|.||||..     ..::.|:|..|:.:|||.|.||:..:   .::.....||..|.:| :
  Fly    82 GHLKITRDQRFKI-----VGDYNLQINGVKTQDAGDYICQLGDQENRDQVHTVEILVPPTLRA-L 140

  Fly   198 LANRELFIQSGSDINLTCIAPQAPGPYTHMLWHK------DTELVSDSARGGIRVESEQQMKTSN 256
            ..|.::..:.||.:.|.|.|...|.|  .:.|.|      .|.| |||               |.
  Fly   141 PHNGQVTARKGSTVTLECKASGNPVP--TIFWFKKDVFSGPTHL-SDS---------------ST 187

  Fly   257 LVISRVQHTDSGNYTCSADNSNSDSVFVHI 286
            |::..|....:|.|.|||||...|.|.:.|
  Fly   188 LILENVDRHHAGTYQCSADNGVKDRVSMDI 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 29/105 (28%)
IG_like 98..179 CDD:214653 25/87 (29%)
IG_like 206..278 CDD:214653 24/77 (31%)
Ig 211..278 CDD:143165 22/72 (31%)
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 25/89 (28%)
Ig 56..116 CDD:143165 21/66 (32%)
IG_like 144..221 CDD:214653 27/92 (29%)
IGc2 151..209 CDD:197706 24/75 (32%)
IG_like 232..313 CDD:214653
Ig 242..311 CDD:143165
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.