DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and Dscam2

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster


Alignment Length:335 Identity:71/335 - (21%)
Similarity:103/335 - (30%) Gaps:130/335 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 DREVI-AALGTTARLHC----RVRHLGDRAVSWIRQRDL------------HILTIGIMTYTN-- 142
            |.||: ||.|.||.|.|    .|:.| .|.|||:.:..:            |:|..|.:...|  
  Fly   136 DVEVLSAARGCTAILRCVVPTFVKEL-VRVVSWVHEPAIYIYPSLQGDGKFHLLPTGELLIHNLQ 199

  Fly   143 ----DQRFLAR-----------------------------------HIDNSDE------------ 156
                .|.|..|                                   |:..|.:            
  Fly   200 ESDESQSFRCRSMHRLTRQVVVSSPTRLRINSHRGIISPSVVEHTAHVQVSQDEGAVLLCVAQGC 264

  Fly   157 ------W----------------------VLKIVSVQQRDAGVYEC---QVSTEPKISLAYKLVV 190
                  |                      :|.|.:|...|:|||:|   .|..|....|  :|.|
  Fly   265 PSPEYSWFTHNGAGPLPVLSGPRVRLLGPILAIEAVTGEDSGVYKCTAGNVGGEASAEL--RLTV 327

  Fly   191 VTSKAQILANRELFIQSGSDINLTCIAPQ--APGPYTHMLWHKDTELVSDSARGGIRVESEQQMK 253
            .|.....::...|.:..|......|:...  :|....::||:||...:..|.    |||      
  Fly   328 ATPIQVEISPNVLSVHMGGTAEFRCLVTSNGSPVGMQNILWYKDGRQLPSSG----RVE------ 382

  Fly   254 TSNLVISRVQHTDSGNYTCSADNSNSDSVFVHIIKSEQHAAMQHELGSRLLLPPLPLLLLAVLLV 318
             ..||:.||...:.|.|.|.......|:.         .|..:.:||.   .||: ||...:...
  Fly   383 -DTLVVPRVSRENRGMYQCVVRRPEGDTF---------QATAELQLGD---APPV-LLYSFIEQT 433

  Fly   319 VLLGPTSSLQ 328
            :..||..||:
  Fly   434 LQPGPAVSLK 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 38/194 (20%)
IG_like 98..179 CDD:214653 34/181 (19%)
IG_like 206..278 CDD:214653 18/73 (25%)
Ig 211..278 CDD:143165 17/68 (25%)
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845 19/65 (29%)
I-set 238..327 CDD:254352 15/90 (17%)
Ig 247..327 CDD:299845 14/81 (17%)
I-set 332..418 CDD:254352 21/105 (20%)
IGc2 344..407 CDD:197706 18/73 (25%)
IG_like 432..517 CDD:214653 4/12 (33%)
IGc2 436..507 CDD:197706 4/8 (50%)
I-set 521..610 CDD:254352
IGc2 533..597 CDD:197706
Ig 630..699 CDD:143165
IG_like 714..802 CDD:214653
Ig 725..802 CDD:299845
Ig 823..894 CDD:143165
FN3 906..1006 CDD:238020
FN3 1013..1111 CDD:238020
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.