Sequence 1: | NP_650080.3 | Gene: | dpr5 / 41381 | FlyBaseID: | FBgn0037908 | Length: | 336 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001261500.1 | Gene: | Dscam2 / 38788 | FlyBaseID: | FBgn0265296 | Length: | 2101 | Species: | Drosophila melanogaster |
Alignment Length: | 335 | Identity: | 71/335 - (21%) |
---|---|---|---|
Similarity: | 103/335 - (30%) | Gaps: | 130/335 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 97 DREVI-AALGTTARLHC----RVRHLGDRAVSWIRQRDL------------HILTIGIMTYTN-- 142
Fly 143 ----DQRFLAR-----------------------------------HIDNSDE------------ 156
Fly 157 ------W----------------------VLKIVSVQQRDAGVYEC---QVSTEPKISLAYKLVV 190
Fly 191 VTSKAQILANRELFIQSGSDINLTCIAPQ--APGPYTHMLWHKDTELVSDSARGGIRVESEQQMK 253
Fly 254 TSNLVISRVQHTDSGNYTCSADNSNSDSVFVHIIKSEQHAAMQHELGSRLLLPPLPLLLLAVLLV 318
Fly 319 VLLGPTSSLQ 328 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr5 | NP_650080.3 | V-set | 95..191 | CDD:284989 | 38/194 (20%) |
IG_like | 98..179 | CDD:214653 | 34/181 (19%) | ||
IG_like | 206..278 | CDD:214653 | 18/73 (25%) | ||
Ig | 211..278 | CDD:143165 | 17/68 (25%) | ||
Dscam2 | NP_001261500.1 | Ig | 51..127 | CDD:299845 | |
Ig | 138..>203 | CDD:299845 | 19/65 (29%) | ||
I-set | 238..327 | CDD:254352 | 15/90 (17%) | ||
Ig | 247..327 | CDD:299845 | 14/81 (17%) | ||
I-set | 332..418 | CDD:254352 | 21/105 (20%) | ||
IGc2 | 344..407 | CDD:197706 | 18/73 (25%) | ||
IG_like | 432..517 | CDD:214653 | 4/12 (33%) | ||
IGc2 | 436..507 | CDD:197706 | 4/8 (50%) | ||
I-set | 521..610 | CDD:254352 | |||
IGc2 | 533..597 | CDD:197706 | |||
Ig | 630..699 | CDD:143165 | |||
IG_like | 714..802 | CDD:214653 | |||
Ig | 725..802 | CDD:299845 | |||
Ig | 823..894 | CDD:143165 | |||
FN3 | 906..1006 | CDD:238020 | |||
FN3 | 1013..1111 | CDD:238020 | |||
FN3 | 1119..1209 | CDD:238020 | |||
FN3 | 1219..1313 | CDD:238020 | |||
Ig | 1336..1402 | CDD:143165 | |||
FN3 | 1409..1498 | CDD:238020 | |||
FN3 | 1515..1588 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |