DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and dpr20

DIOPT Version :10

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster


Alignment Length:363 Identity:97/363 - (26%)
Similarity:155/363 - (42%) Gaps:82/363 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VRATFTSTTATESSPLIGKVISNSRAPQIAHEMLVEYFMALLVIMGLTAPVDKQSRRSSQYFGHL 71
            |.|...:|.||.||.|    .|:|.|                   .|..|.:....||:....:.
  Fly   181 VNALVPATVATTSSGL----PSSSNA-------------------SLATPTEPARNRSTGLVRNS 222

  Fly    72 AAAEE--------------LSNLIPDNYDAID----------PVFDN------TTDREVIAALGT 106
            |...:              :.|.|.|.:.:.:          |.|::      .|:..|.|  |:
  Fly   223 AVKVDSKHPLSKGQKTDAPMLNYIFDTFSSANKHHHHDQRYGPHFEDVQRIGQATNLTVQA--GS 285

  Fly   107 TARLHCRVRHLGDRAVSWIRQRD----------LHILTIGIMTYTNDQRFLARHIDNSDEWVLKI 161
            :..|:||:..|.|:.|||:|...          |.:||:|:.|||.|:|: .......:.|.|||
  Fly   286 SIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRY-KMEFQYPNNWRLKI 349

  Fly   162 VSVQQRDAGVYECQVSTEPKISLAYKLVVVTSKAQILAN-----RELFIQSGSDINLTCIAPQAP 221
            .:|::.|..:||||:||.|...:...|.|...|..|:..     :|.:.:..|.:.|:|:.....
  Fly   350 TNVKKDDEAIYECQISTHPPRVIQINLHVNAPKVMIVDEVGDPLQEKYYEIDSTLQLSCVVRNVA 414

  Fly   222 GPYTHMLW-HKDTELVSDSARGGIRVESE--QQMKTSNLVISRVQHTDSGNYTCSADNSNSDSVF 283
            ...:.:.| |.|..|..|..|||:.|::|  :....|.|.|:::..|||||||||.....:.::.
  Fly   415 MTSSVVFWKHMDNILNYDVTRGGVSVKTELMEDGANSTLSIAKISKTDSGNYTCSISEFQNFTIV 479

  Fly   284 VHIIKSEQHAAMQH--ELG------SRLLLPPLPLLLL 313
            |||:..|..|.:.|  .:|      :.::|..:.||:|
  Fly   480 VHILNGESFAELHHGGAVGWHSTWWNMVMLHAMALLVL 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 FR1 96..113 CDD:409355 5/16 (31%)
IG_like 98..179 CDD:214653 32/90 (36%)
Ig strand A' 100..102 CDD:409355 1/1 (100%)
Ig strand B 106..114 CDD:409355 2/7 (29%)
CDR1 114..120 CDD:409355 1/5 (20%)
FR2 121..132 CDD:409355 5/20 (25%)
Ig strand C 121..127 CDD:409355 3/5 (60%)
Ig strand C' 130..133 CDD:409355 1/2 (50%)
CDR2 133..146 CDD:409355 7/12 (58%)
Ig strand D 146..151 CDD:409355 0/4 (0%)
FR3 147..176 CDD:409355 9/28 (32%)
Ig strand E 155..162 CDD:409355 3/6 (50%)
Ig strand F 170..177 CDD:409355 4/6 (67%)
IG_like 206..278 CDD:214653 25/74 (34%)
Ig strand B 211..215 CDD:409353 1/3 (33%)
Ig strand C 226..230 CDD:409353 1/4 (25%)
Ig strand E 255..259 CDD:409353 2/3 (67%)
Ig strand F 269..274 CDD:409353 4/4 (100%)
dpr20NP_612066.1 PHA02785 101..368 CDD:165149 55/212 (26%)
IG_like 278..365 CDD:214653 31/89 (35%)
Ig strand B 287..291 CDD:409382 1/3 (33%)
Ig strand C 300..304 CDD:409382 2/3 (67%)
Ig strand E 345..349 CDD:409382 2/3 (67%)
Ig strand F 359..364 CDD:409382 3/4 (75%)
Ig strand G 371..374 CDD:409382 0/2 (0%)
IG_like 402..480 CDD:214653 25/77 (32%)
Ig strand B 404..408 CDD:409353 1/3 (33%)
Ig strand C 417..423 CDD:409353 0/5 (0%)
Ig strand E 451..455 CDD:409353 2/3 (67%)

Return to query results.
Submit another query.