DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and wrapper

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster


Alignment Length:275 Identity:64/275 - (23%)
Similarity:100/275 - (36%) Gaps:69/275 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 QSRRSSQYF-------GHLAAAEELS-NLIPDNYDAIDPVFDNTTDREVIAALGTTARLHCRVRH 116
            ||..:..|:       ||:.....:. .|.|.  ..|:| .|.|..|     :|....:.|..:.
  Fly   102 QSSDTGDYYCEMNSDSGHVVQQHAIEVQLAPQ--VLIEP-SDLTEQR-----IGAIFEVVCEAQG 158

  Fly   117 LGDRAVSWIRQRDLHILTIGIMTYTNDQRFLARHIDNSDEWVLKIVSVQQRDAGVYECQVST--- 178
            :....::|....::      |...:|        ..|....:|:|.|..|  ||:.||..|.   
  Fly   159 VPQPVITWRLNGNV------IQPQSN--------TGNRQSLILEIKSRNQ--AGLIECVASNGVG 207

  Fly   179 EPKISLAYKLVVVTSKAQILANRELFIQSGSDINLTCIAPQAPGPYTHMLWHKDTELVSDSARGG 243
            ||.::..| |.|:.|....:....::.:.||..:|.||...||.. |...:|....:    |.|.
  Fly   208 EPAVANVY-LHVLFSPEVSIPQPVVYTKLGSRAHLECIVEAAPAA-TVKWFHHGLPV----ALGA 266

  Fly   244 IRVESEQQMKTSN------------LVISRVQHTDSGNYTCSADNSNSDSVFVHIIKSEQHAAMQ 296
            .....|.:::|:.            ||:..|::.|.|.|.|.|.|..|       :||.     .
  Fly   267 HSTTHESELQTNRSVDHYVNAVRHMLVVKSVRNADMGQYECRASNQIS-------VKSG-----S 319

  Fly   297 HELGSRLLLPPLPLL 311
            .||..|    |:|.|
  Fly   320 VELTGR----PMPCL 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 21/98 (21%)
IG_like 98..179 CDD:214653 16/83 (19%)
IG_like 206..278 CDD:214653 22/83 (27%)
Ig 211..278 CDD:143165 20/78 (26%)
wrapperNP_477404.1 Ig 41..124 CDD:299845 5/21 (24%)
IG_like 41..118 CDD:214653 3/15 (20%)
IG_like 145..218 CDD:214653 20/94 (21%)
Ig 147..219 CDD:299845 19/88 (22%)
I-set 224..323 CDD:254352 26/115 (23%)
IGc2 236..314 CDD:197706 22/82 (27%)
FN3 339..431 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.