DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and DIP-zeta

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster


Alignment Length:237 Identity:69/237 - (29%)
Similarity:104/237 - (43%) Gaps:29/237 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 SNLIPDNYDAIDPVFDNTTDREVIAALGTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTN 142
            |||   |....:|.|....:...:.| |...:|.|.|::||...|:|:......|||:.....|.
  Fly   104 SNL---NIVVEEPEFTEYIENVTVPA-GRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITR 164

  Fly   143 DQRFLARHIDNSDE---WVLKIVSVQQRDAGVYECQVST-EPKISLAYKLVVVTSKA-QILANRE 202
            :.|....| |..|.   |.|.|.:|.:.|.|.|.||::| ..|....|..|||.... ..|::.:
  Fly   165 NPRISVTH-DKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSD 228

  Fly   203 LFIQSGSDINLTCIAPQAPGPYTHMLWHKDTELVSDSARGGI---RVESEQQMKTSNLVISRVQH 264
            :.::.|::|:|.|.|..:|.|.  :.|.:|     |::|..|   .:.:|.:..|  |.|:|:..
  Fly   229 VIVREGANISLRCRASGSPRPI--IKWKRD-----DNSRIAINKNHIVNEWEGDT--LEITRISR 284

  Fly   265 TDSGNYTCSADNSNSDSVFVHIIKSEQHAAMQHELGSRLLLP 306
            .|.|.|.|.|.|....:|...|..|.....|       ||:|
  Fly   285 LDMGAYLCIASNGVPPTVSKRIKVSVDFPPM-------LLIP 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 30/99 (30%)
IG_like 98..179 CDD:214653 27/84 (32%)
IG_like 206..278 CDD:214653 23/74 (31%)
Ig 211..278 CDD:143165 22/69 (32%)
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 30/97 (31%)
Ig 130..200 CDD:143165 23/70 (33%)
I-set 226..310 CDD:254352 25/92 (27%)
IGc2 233..298 CDD:197706 23/73 (32%)
Ig 313..410 CDD:299845 4/14 (29%)
IG_like 325..410 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.