DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and DIP-iota

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster


Alignment Length:259 Identity:71/259 - (27%)
Similarity:105/259 - (40%) Gaps:53/259 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 AAAEELSNLIPDNYDAIDPVFDNTTDREVIAALGTTARLHCRVRHLGDRAVSWIRQRDLHILTIG 136
            |:..||:|        .||.|....:...: .:|..|.|.|.|..|....|:|:|.....||:|.
  Fly    21 ASFSELNN--------SDPKFSGPINNSTV-PVGRDALLTCVVHDLVSFKVAWLRVDTQTILSIQ 76

  Fly   137 IMTYTNDQRFLARHIDNSDEWVLKIVSVQQRDAGVYECQVSTEP-KISLAYKLVVVTSK-AQILA 199
            ....|.:.|....|.::. .|.|||..||:.|.|.|.||::|:| |..:.|..|||... .....
  Fly    77 NHVITKNHRISISHTEHR-IWQLKIRDVQESDRGWYMCQINTDPMKSQMGYLDVVVPPDIVDYQT 140

  Fly   200 NRELFIQSGSDINLTCIAPQAPGPYTHMLWHKDTE---LVSDSA-RGGIRVESEQQMKTSNLVIS 260
            ::::...:|.::.|||.|...|.|  .:.|.::..   |:||.. |....||.:      ||.:.
  Fly   141 SQDVVRSTGQNVTLTCSATGVPMP--TITWRREEATPILISDDGDREVFSVEGQ------NLTLW 197

  Fly   261 RVQHTDSGNYTCSADNSNSDSVFVHIIKSEQHAAMQHELGSRLLLPPLPLLLLAVLLVVLLGPT 324
            :||.:..|.|.|.|.|.                           :|  |.:...|:|||...||
  Fly   198 QVQRSHMGAYLCIASNG---------------------------VP--PTVSKRVMLVVNFAPT 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 31/96 (32%)
IG_like 98..179 CDD:214653 26/80 (33%)
IG_like 206..278 CDD:214653 23/75 (31%)
Ig 211..278 CDD:143165 22/70 (31%)
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 29/87 (33%)
Ig 39..122 CDD:299845 28/84 (33%)
Ig 132..213 CDD:299845 22/88 (25%)
IG_like 141..227 CDD:214653 27/122 (22%)
IG_like 239..322 CDD:214653
IGc2 245..313 CDD:197706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.