DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and fipi

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster


Alignment Length:195 Identity:40/195 - (20%)
Similarity:73/195 - (37%) Gaps:47/195 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 AVSWIRQRD---LHILTIGIMTYTNDQRFL--------------------------ARHIDNSDE 156
            ||:|....:   |......::.|||:...:                          ..||:.:..
  Fly    15 AVAWANHHESLSLSPAEHSVVRYTNESLIVQCRSPDPKVELHWKSPKGEIIREHKGRIHIEQTST 79

  Fly   157 WVLKIV--SVQQRDAGVYECQVSTEPKISLAYKLVV-----VTSKAQILANRELFIQSGSDINLT 214
            ..||||  .:...|.|.:.|:.:.....|.::.|:|     .|..|.::.     ::.|....:.
  Fly    80 EQLKIVFAHIALADKGNWSCEAADGSLHSKSFDLIVYQKITFTENATVMT-----VKEGEKATIL 139

  Fly   215 CIAPQAPGPYTHMLWHKDTELVSDSARGGIRVESEQQMKTSNLVISRVQHTDSGNYTCSADNSNS 279
            |.....|.|  ::.||.:.:.:|    .|...:|:.::....|:|::|...|:|.|.|.|...||
  Fly   140 CEVKGEPQP--NVTWHFNGQPIS----AGAADDSKFRILADGLLINKVTQNDTGEYACRAYQVNS 198

  Fly   280  279
              Fly   199  198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 19/105 (18%)
IG_like 98..179 CDD:214653 16/88 (18%)
IG_like 206..278 CDD:214653 17/71 (24%)
Ig 211..278 CDD:143165 16/66 (24%)
fipiNP_787975.1 IG_like 33..115 CDD:214653 14/81 (17%)
I-set 128..202 CDD:254352 19/82 (23%)
Ig 133..>193 CDD:299845 16/65 (25%)
IG_like 228..307 CDD:214653
Ig 235..305 CDD:143165
FN3 312..415 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.