Sequence 1: | NP_650080.3 | Gene: | dpr5 / 41381 | FlyBaseID: | FBgn0037908 | Length: | 336 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_787975.1 | Gene: | fipi / 33676 | FlyBaseID: | FBgn0031627 | Length: | 450 | Species: | Drosophila melanogaster |
Alignment Length: | 195 | Identity: | 40/195 - (20%) |
---|---|---|---|
Similarity: | 73/195 - (37%) | Gaps: | 47/195 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 121 AVSWIRQRD---LHILTIGIMTYTNDQRFL--------------------------ARHIDNSDE 156
Fly 157 WVLKIV--SVQQRDAGVYECQVSTEPKISLAYKLVV-----VTSKAQILANRELFIQSGSDINLT 214
Fly 215 CIAPQAPGPYTHMLWHKDTELVSDSARGGIRVESEQQMKTSNLVISRVQHTDSGNYTCSADNSNS 279
Fly 280 279 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr5 | NP_650080.3 | V-set | 95..191 | CDD:284989 | 19/105 (18%) |
IG_like | 98..179 | CDD:214653 | 16/88 (18%) | ||
IG_like | 206..278 | CDD:214653 | 17/71 (24%) | ||
Ig | 211..278 | CDD:143165 | 16/66 (24%) | ||
fipi | NP_787975.1 | IG_like | 33..115 | CDD:214653 | 14/81 (17%) |
I-set | 128..202 | CDD:254352 | 19/82 (23%) | ||
Ig | 133..>193 | CDD:299845 | 16/65 (25%) | ||
IG_like | 228..307 | CDD:214653 | |||
Ig | 235..305 | CDD:143165 | |||
FN3 | 312..415 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |