DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and bdl

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster


Alignment Length:245 Identity:59/245 - (24%)
Similarity:100/245 - (40%) Gaps:43/245 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 IDPVFDNTTDREVIAALGTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTNDQRFLARHID 152
            |.||  |.|.||     |.||..||.::|..:...||.:.        |::  ..:.:.|.|...
  Fly   155 IPPV--NQTIRE-----GQTAFFHCVMKHPENSQASWYKD--------GVL--LQEVQDLVRRFY 202

  Fly   153 NSDEWVLKIVSVQQRDAGVYECQV-STEPKISLAYKLVVVTSKAQIL-ANRELFIQSGSDINLTC 215
            ...:..|.|......|.|.|||:| :::.::..|...:.:..||::: |..|:|:..|....|.|
  Fly   203 MGPDGSLSIDPTMMSDLGEYECKVRNSDGELQTAKAFLNIQYKAKVIYAPPEVFLPYGQPAVLDC 267

  Fly   216 IAPQAPGPYTHMLWHKDTELVSDSARGGIRVESEQQMKTSNLVISRVQHTDSGNYTCSADN---S 277
            .....| |..::.|.|| .|:.||    ..|.........:|..::|....:|:|||:..|   :
  Fly   268 HFRANP-PLKNLRWEKD-GLLFDS----YNVPGVFYKMNGSLFFAKVDENHAGSYTCTPYNDLGT 326

  Fly   278 NSDSVFVHIIKSEQHAAMQHELGSRLLLPPLPLLLLAVLLVVLLGPTSSL 327
            :..|..:.:|               :|.||:..:....:.:..||..:.|
  Fly   327 DGPSPVISVI---------------VLRPPIFSVTPKAIYIQKLGEAAEL 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 23/96 (24%)
IG_like 98..179 CDD:214653 21/81 (26%)
IG_like 206..278 CDD:214653 19/74 (26%)
Ig 211..278 CDD:143165 18/69 (26%)
bdlNP_608822.1 IG_like 42..128 CDD:214653
Ig 43..131 CDD:299845
I-set 153..242 CDD:254352 27/103 (26%)
Ig 157..242 CDD:299845 26/101 (26%)
Ig_2 252..337 CDD:290606 23/105 (22%)
IG_like 260..327 CDD:214653 19/72 (26%)
I-set 341..428 CDD:254352 4/21 (19%)
IGc2 356..419 CDD:197706 2/6 (33%)
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.