DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and itgb4

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_005166847.1 Gene:itgb4 / 335269 ZFINID:ZDB-GENE-030131-7209 Length:1931 Species:Danio rerio


Alignment Length:246 Identity:50/246 - (20%)
Similarity:81/246 - (32%) Gaps:64/246 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VDKQSRRSSQYFGHLAAAEELSNLIPD---NYDAI------DPVFDNTTDREVIAALGTTA---- 108
            |...|:.:|..:...:.|...|..|.|   |.|::      .|....|..|.|.:|||.||    
Zfish  1592 VSSFSQTTSTSYSLSSRARTQSEDINDALLNLDSVLQESRFTPGVPATPSRLVFSALGHTALKVS 1656

  Fly   109 --RLHCRVRHLGDRAV-SWIRQRDLHILTIGIMTYTNDQRFLARHIDNSDEWVLKIVSVQQRDA- 169
              ..||....||...: ..|...|:..:.:......:   .|.:.:..:..::.| |..|.|:. 
Zfish  1657 WQEPHCESDVLGYCVLYQLINGGDVKRIEVNNPAQNS---VLVQDLLPNQSYIFK-VKAQSREGW 1717

  Fly   170 -----GVYECQVSTEPKISLAYKLVVVTSKAQILANRELFIQSGSDINLTCIAPQAPGPYTHMLW 229
                 ||...:.:.:||..|:                   ...||...|:  .|.||||......
Zfish  1718 GPEREGVITIESNVDPKSPLS-------------------PVPGSPFTLS--TPSAPGPLIFTAL 1761

  Fly   230 HKDTELVSDSARGGIRVESEQQMKTSNLVISRVQHTDSGNYTCSADNSNSD 280
            ..||          :::..|:..|.:..::..|       .||...:...|
Zfish  1762 RPDT----------LQLSWEKPRKPNGDILGYV-------VTCEQLHGGGD 1795

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 24/108 (22%)
IG_like 98..179 CDD:214653 20/93 (22%)
IG_like 206..278 CDD:214653 15/71 (21%)
Ig 211..278 CDD:143165 13/66 (20%)
itgb4XP_005166847.1 Integrin_beta 37..457 CDD:278776
EGF_2 <468..490 CDD:285248
EGF_2 545..573 CDD:285248
Integrin_B_tail 625..709 CDD:285239
Calx-beta 991..1064 CDD:295344
FN3 1242..1326 CDD:238020
FN3 1331..1420 CDD:238020
fn3 1640..1720 CDD:278470 18/83 (22%)
fn3 1751..1835 CDD:278470 12/62 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.