DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and dpr2

DIOPT Version :10

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster


Alignment Length:360 Identity:119/360 - (33%)
Similarity:181/360 - (50%) Gaps:65/360 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SSPLIGKVISNSRA------------------PQIAHEMLVEYFMALLVIMGLTAPVDKQ----- 60
            ::|::..:||.|||                  ..::|  ||:....||.::...:.:|..     
  Fly    12 ATPILVIMISISRAWTMQQQHLSPAIQQHPAVKSLSH--LVDGNDNLLPMVSAPSSIDNDYVYIA 74

  Fly    61 --SRRSSQYFGHLAAAEELSNLIPDNYDAIDPVFDNTTDREVIAALGTTARLHCRVRHLGDRAVS 123
              :|:..|:...:....|.....|:......||||....|.:....|.||.::|||.:|||::||
  Fly    75 SVNRKFPQFGNSIDDEREAEEQPPEETTYPPPVFDFGMPRNITTRTGHTAAINCRVDNLGDKSVS 139

  Fly   124 WIRQRDLHILTIGIMTYTNDQRFLARHIDNSDEWVLKIVSVQQRDAGVYECQVSTEPKISLAYKL 188
            |||:|||||||.||:|||:|:||......:|.:|.|.:...|.||:|:|||||:||||||:|::|
  Fly   140 WIRKRDLHILTAGILTYTSDERFKVVRTADSKDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRL 204

  Fly   189 -VVVT---SKAQILANRELFIQSGSDINLTC------IAPQAPGPYTHMLWHKDTELV------- 236
             |:||   :||.|....:|:::.||.:.|||      .:.|..||   :.|::...::       
  Fly   205 NVIVTPPDAKAIIAGPTDLYVKVGSSVTLTCHVKQPATSAQDIGP---IYWYRGPYILTPFVAHP 266

  Fly   237 SDSARGGIRVESEQQMK---TSNLVISRVQHTDSGNYTCSADNSNSDSVFVHIIKSEQHAAMQHE 298
            :|:|....|:..|..:.   .|.|.|:..|..|:|||||....:.:.||.|::|..|..||||..
  Fly   267 NDAAIDLQRISMESTLAEKLQSRLRIANAQLLDTGNYTCMPTTAEAASVVVNVINDESPAAMQKS 331

  Fly   299 ---------LGSRLLLPPLPLLLLAVLLVV--LLG 322
                     ..|||:|    ||.:....||  |:|
  Fly   332 RAIRTSGSMRSSRLVL----LLAMVASSVVRWLIG 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 FR1 96..113 CDD:409355 4/16 (25%)
IG_like 98..179 CDD:214653 42/80 (53%)
Ig strand A' 100..102 CDD:409355 0/1 (0%)
Ig strand B 106..114 CDD:409355 3/7 (43%)
CDR1 114..120 CDD:409355 3/5 (60%)
FR2 121..132 CDD:409355 8/10 (80%)
Ig strand C 121..127 CDD:409355 4/5 (80%)
Ig strand C' 130..133 CDD:409355 2/2 (100%)
CDR2 133..146 CDD:409355 8/12 (67%)
Ig strand D 146..151 CDD:409355 1/4 (25%)
FR3 147..176 CDD:409355 10/28 (36%)
Ig strand E 155..162 CDD:409355 2/6 (33%)
Ig strand F 170..177 CDD:409355 5/6 (83%)
IG_like 206..278 CDD:214653 23/87 (26%)
Ig strand B 211..215 CDD:409353 1/3 (33%)
Ig strand C 226..230 CDD:409353 0/3 (0%)
Ig strand E 255..259 CDD:409353 2/3 (67%)
Ig strand F 269..274 CDD:409353 4/4 (100%)
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 50/92 (54%)
Ig strand A' 116..118 CDD:409355 0/1 (0%)
Ig strand B 122..130 CDD:409355 3/7 (43%)
CDR1 130..136 CDD:409355 3/5 (60%)
FR2 137..151 CDD:409355 11/13 (85%)
Ig strand C 137..143 CDD:409355 4/5 (80%)
Ig strand C' 149..153 CDD:409355 2/3 (67%)
CDR2 153..162 CDD:409355 5/8 (63%)
Ig strand D 162..167 CDD:409355 1/4 (25%)
FR3 163..192 CDD:409355 10/28 (36%)
Ig strand E 172..178 CDD:409355 2/5 (40%)
Ig strand F 186..192 CDD:409355 4/5 (80%)
IG_like 220..306 CDD:214653 23/88 (26%)
Ig strand B 231..235 CDD:409353 1/3 (33%)
Ig strand C 261..265 CDD:409353 0/3 (0%)
Ig strand E 289..292 CDD:409353 1/2 (50%)
Ig strand F 302..307 CDD:409353 4/4 (100%)
Ig strand G 310..313 CDD:409353 0/2 (0%)

Return to query results.
Submit another query.